KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663235
Entry
104663235         CDS       T03989                                 

Gene name
HTR1D
Definition
(RefSeq) 5-hydroxytryptamine receptor 1D
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04024  cAMP signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04726  Serotonergic synapse
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    104663235 (HTR1D)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104663235 (HTR1D)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    104663235 (HTR1D)
  09157 Sensory system
   04742 Taste transduction
    104663235 (HTR1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104663235 (HTR1D)
G protein-coupled receptors [BR:rro04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    104663235 (HTR1D)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 104663235
NCBI-ProteinID: XP_010362671
UniProt: A0A2K6NAW6
LinkDB
Position
12
AA seq 377 aa
MSPLNQSTEGLPQEASNRSLNAVETPEAWDPRTLQALKISLAVVLSIITLATVLSNAFVL
TTILLTKKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT
TAHLITGSAGSSLCSLNRSLHEGHSHSAGSPLFFSHVKIKLADSALERKRISAARERKAT
KTLGIILGAFLICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFRKFVPFRKSS
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtccccactgaaccagtcaacagaaggccttccccaggaggcctccaacagatccctg
aatgccgtagaaaccccagaggcttgggatcccaggaccctccaggcactcaagatctcc
cttgctgtggtcctttccatcatcacactggccacagtcctctccaacgcctttgtactc
accaccatcttactcaccaagaagctccatacccctgccaactacctgattggctccctg
gccaccaccgacctcttggtttccatcttggtcatgcccatcagcattgcctataccatc
acccacacctggaactttggccaaatcttgtgtgacatctggctgtcttctgacatcacg
tgctgcacggcctccatcctgcatctctgtgtcattgctctggacaggtactgggcgatc
acggatgccctggagtacagtaaacgcaggacggctggccacgcggccaccatgattgcc
atcgtctgggccatctccatctgcatctccattccccctctcttctggcgacaggccaag
gcccaggaggagatgtcggactgcctggtgaacacctctcagatctcctacaccatctat
tccacgtgtggggccttctacattccctcggtgttgctcatcatcctatatggccggatc
taccgggcggcccggaatcgcatcctgaatccaccctcactctatgggaagcgcttcacc
acagcccacctcatcacaggctctgcagggtcctcgctctgttcgctcaaccgcagcctc
catgaggggcactcgcactcggctggctcccctctctttttcagccacgtgaaaatcaag
cttgctgacagtgccctggaacgcaagaggatttctgctgctcgggaaaggaaagccact
aaaactctgggcatcattctgggggcttttctcatctgctggttgcccttcttcgtggtg
tctctggtcctccccatctgccgggactcctgctggatccacccggccctctttgacttc
ttcacctggctaggctatttaaactccctcatcaatccaataatctacactgtgtttaat
gaagagtttcggcaagcctttcggaaatttgtccctttccggaagtcctcttag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664927
Entry
104664927         CDS       T03989                                 

Gene name
HTR1B
Definition
(RefSeq) 5-hydroxytryptamine receptor 1B
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04024  cAMP signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04726  Serotonergic synapse
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    104664927 (HTR1B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104664927 (HTR1B)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    104664927 (HTR1B)
  09157 Sensory system
   04742 Taste transduction
    104664927 (HTR1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104664927 (HTR1B)
G protein-coupled receptors [BR:rro04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    104664927 (HTR1B)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 104664927
NCBI-ProteinID: XP_010364919
UniProt: A0A2K6NJ45
LinkDB
Position
4
AA seq 390 aa
MEEPGAQCAPPPPAGSETWAPQANVSSAPSQNCSTKDYIYQDSIALPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPVSTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSDCVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggaggaaccgggtgctcagtgcgctccaccgccgcccgcgggctccgagacctgggct
cctcaagccaacgtatcctctgctccctcccaaaactgcagcaccaaggactatatttac
caggactccatcgccctaccctggaaagtactgctggttatgctactggcgctcatcacc
ttggccaccacgctctccaatgcctttgtgattgccacagtgtaccggacccggaagcta
cacaccccggctaactatctaatcgcctctctggcggtcaccgacctgctcgtgtccatc
ctggtgatgccggtcagcaccatgtacactgtcaccggccgctggacactgggccaggtg
gtctgtgacttctggctgtcgtcggacatcacctgttgcactgcctccatcctgcacctc
tgtgtcatcgccctggaccgctactgggccatcacggacgctgtggagtactcagctaaa
aggactcccaagagggcggcggtcatgatcgcgctggtgtgggtcttctccatctctatc
tcgctgccgcccttcttctggcgtcaggccaaggccgaagaggaggtgtcggactgcgtg
gtgaacaccgaccacatcctctacacggtctactccacggtgggtgctttctactttccc
accctgctcctcatcgccctctatggccgcatctacgtggaagcccgctcccggattttg
aaacagacgcccaacaggaccggcaagcgcttgacccgagcccagctgataacggactcc
cccgggtccacgtcttcggtcacctctattaactcgcgggttcccgacgtgcccagcgaa
tccgggtctcctgtgtacgtgaaccaagtcaaagtgcgagtctccgacgccctgctggaa
aagaagaaactcatggccgctagggagcgcaaagccaccaagaccctggggatcattttg
ggagcctttattgtgtgttggctgcccttcttcatcatctccctagtgatgccgatctgc
aaagatgcctgctggttccacctagccatctttgacttcttcacatggctgggctatctc
aactccctcattaaccccataatctataccatgtccaatgaggactttaaacaagcgttc
cacaaactgatacgttttaagtgcacgagttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104666170
Entry
104666170         CDS       T03989                                 

Gene name
HTR1A
Definition
(RefSeq) 5-hydroxytryptamine receptor 1A
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04024  cAMP signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04726  Serotonergic synapse
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    104666170 (HTR1A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104666170 (HTR1A)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    104666170 (HTR1A)
  09157 Sensory system
   04742 Taste transduction
    104666170 (HTR1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104666170 (HTR1A)
G protein-coupled receptors [BR:rro04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    104666170 (HTR1A)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx Cecropin
Other DBs
NCBI-GeneID: 104666170
NCBI-ProteinID: XP_010366482
UniProt: A0A2K6QKE7
LinkDB
Position
3
AA seq 422 aa
MDVLSPGQGNNTTSPPGPFETGGNTTGISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGANT
RHAASPAPQPKKSVNGESGDRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGSTPCASASFERKNERNADAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RQ
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggatgtgctcagccctggtcagggcaacaacaccacatcaccaccgggtccctttgag
accggcggcaacactactggtatctccgacgtgaccttcagctaccaagtgatcacctct
ctgctgctgggcacgctcatcttctgcgcggtgctgggcaatgcgtgcgtggtggctgcc
atcgccttagagcgctccctgcagaacgtggccaattatcttattggctctttggcggtc
accgacctcatggtgtcggtgttagtgctgcccatggccgcgctgtatcaggtgctcaac
aagtggacactgggccaggtcacctgcgacctgttcatcgccctcgacgtgctgtgctgc
acctcatccatcctgcacctgtgcgccatcgcgctggacaggtactgggccatcacggac
cccatcgactacgtgaacaagaggacgccccggcgcgccgctgcgctcatctcgctcact
tggcttattggcttcctcatttctatcccgcccatgctgggctggcgcaccccggaagac
cgctcggaccccgacgcatgcaccattagcaaggaccacggctacactatttactccact
ttcggagctttctacatcccgctgctgctcatgctggttctctatgggcgcatattccga
gctgcgcgcttccgcatccgcaagactgtcaaaaaggtggagaagaccggagccaacacc
cgtcatgcagcatctcccgccccgcagcccaagaagagcgtgaatggagagtcgggggac
aggaactggaggctgggcgtggagagcaaggcagggggtgctctgtgcgccaatggcgcc
gtgaggcaaggcgacgatggcgccgccctggaggtgatcgaggtgcaccgagtgggcaac
tccaaagagcacttgcctctgcccagcgaggctggttctaccccttgtgcctccgcctct
ttcgagaggaaaaatgagcgcaacgccgatgcgaagcgcaagatggccctggcccgagag
aggaagacagtgaagacgctgggcatcatcatgggcaccttcatcctctgctggctgccc
ttcttcatcgtggctcttgttctgcccttctgcgagagcagctgccacatgccaacgctg
ttgggcgccataatcaattggctgggttactccaactctttgcttaatccggtcatttac
gcatacttcaacaaggactttcaaaacgcgtttaagaagatcattaagtgtaagttctgc
cgccagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670760
Entry
104670760         CDS       T03989                                 

Gene name
HTR1F
Definition
(RefSeq) 5-hydroxytryptamine receptor 1F
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04024  cAMP signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04726  Serotonergic synapse
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    104670760 (HTR1F)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104670760 (HTR1F)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    104670760 (HTR1F)
  09157 Sensory system
   04742 Taste transduction
    104670760 (HTR1F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104670760 (HTR1F)
G protein-coupled receptors [BR:rro04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    104670760 (HTR1F)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx DUF2208 7tm_4
Other DBs
NCBI-GeneID: 104670760
NCBI-ProteinID: XP_030795594
LinkDB
Position
1
AA seq 366 aa
MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANY
LICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALD
RYRAITDAVEYARKRTPKHAGIMITVVWIISVFISMPPLFWRHQGTSRDDECIIKHDHIV
STIYSTFGAFYIPLALILILYYKIYRAAKTLYHKRQASRIAKEEVNGQVLLESSEKSTKS
VSTPYVLEKSLTDPSTDFDKIHSTVRSLRSEFKHEKSWRRQKISGTRERKAATTLGLILG
AFVICWLPFFVKELVVNVCEKCKISEEMSNFLTWLGYLNSLINPLIYTIFNEDFKKAFQK
LVRCRC
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggatttcttaaattcatcggatcaaaacttgacctcagaggaactgttaaacagaatg
ccgtccaaaattctggtgtccctcactctctctgggctggcactgatgacaaccactatc
aactcccttgtgattgctgcaattattgtgacccggaagctgcaccatccagccaattat
ttaatttgctcccttgcagtcacagattttcttgtggctgtcctggtgatgcccttcagc
attgtgtacattgtgagagagagctggattatggggcaagtggtctgtgacatctggctg
agtgttgacatcacctgctgcacgtgctccatcttgcatctctcagctatagctttggat
cggtatcgagcgatcacagatgctgttgagtatgccaggaaaaggactccaaagcatgct
ggcattatgattacagtagtttggattatatctgtttttatctctatgcctcctctattc
tggaggcaccaaggaactagcagagatgatgaatgcatcatcaagcacgaccacattgtt
tccaccatttactcaacatttggagctttctacatcccactggcattgattttgatcctt
tactacaaaatatatcgagcagcaaagacattgtaccacaagagacaagcaagtaggatt
gcaaaggaggaggtgaatggccaagtccttttggagagcagtgagaaaagcactaaatca
gtttccacaccgtatgtactagaaaagtctttaactgatccatcaacagactttgataaa
attcatagcacagtgagaagtctcaggtctgaattcaagcatgagaaatcttggagaagg
caaaagatctcaggtacaagagaacggaaagcagccactaccctgggattaatcttgggt
gcatttgtaatatgttggcttcctttttttgtaaaagaattagttgttaatgtttgtgaa
aaatgtaaaatttctgaagaaatgtccaattttttaacatggcttggatatctcaattcc
cttataaatccactgatttacacaatctttaatgaagatttcaagaaagcattccaaaaa
cttgtgcgatgtcgatgctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104681604
Entry
104681604         CDS       T03989                                 

Gene name
HTR1E
Definition
(RefSeq) 5-hydroxytryptamine receptor 1E
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04024  cAMP signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04726  Serotonergic synapse
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    104681604 (HTR1E)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104681604 (HTR1E)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    104681604 (HTR1E)
  09157 Sensory system
   04742 Taste transduction
    104681604 (HTR1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104681604 (HTR1E)
G protein-coupled receptors [BR:rro04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    104681604 (HTR1E)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srt
Other DBs
NCBI-GeneID: 104681604
NCBI-ProteinID: XP_010386252
UniProt: A0A2K6NK38
LinkDB
Position
4
AA seq 365 aa
MNITNCTTEASMAVRPKTITEKMLICMTLVVITTLTTLLNLAVIMAICTTKKLHQPANYL
ICSLAVTDLLVAVLVMPLSIMYIVMDHWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDR
YWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHHRLSPPPSQCTIQHDHV
IYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFANCKLTQ
TFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAF
ILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIR
CREHT
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgaacatcacaaactgtaccacagaagccagcatggctgtgaggcccaagaccatcact
gagaagatgctcatttgcatgactctggtggtcatcaccaccctcaccacgttgctgaac
ttggcggtgatcatggctatctgcaccaccaagaagctccaccagcctgccaactaccta
atctgttctctggccgtgacggacctcctggtggccgtgctcgtcatgcccctgagcatc
atgtacattgtcatggaccactggaagcttggatacttcctctgtgaggtgtggctgagt
gtggacatgacctgctgcacctgctccatcctccacctctgtgtcattgccctggacagg
tactgggccatcaccaatgctattgaatacgccaggaagaggacggccaagagggcggcg
ctgatgatcctcaccgtctggaccatctccattttcatctccatgccccctctgttttgg
aggagccaccaccgcctaagccctccccctagccagtgcactatccagcacgaccatgtt
atctacaccatttactccacgctgggcgcattttatatccccttgactttaatactgatt
ctctattaccggatttaccacgcggccaagagcctttaccagaaaaggggatcaagtcgg
cacttaagcaacagaagcacagatagccagaattcttttgcaaattgtaaacttacacag
actttctgtgtgtctgacttctccacttcagaccctaccacagagtttgaaaagttccat
gcctccatcaggattccacccttcgacaatgatctagatcacccgggagaacgccagcag
atttctagcaccagggaacggaaggcagcgcgcatcctggggttgattctgggcgcattc
attttgtcctggctgccatttttcatcaaagagttgattgtgggtctgagcatctacacc
gtgtcctccgaagtggccgactttctgacgtggctcggttatgttaattctctgatcaac
cctctgctctatacgagttttaatgaagactttaagctggcttttaaaaagctcattaga
tgccgagagcatacttag

DBGET integrated database retrieval system