KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663301
Entry
104663301         CDS       T03989                                 

Gene name
ITGB1
Definition
(RefSeq) integrin beta-1 isoform X1
  KO
K05719  integrin beta 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04015  Rap1 signaling pathway
rro04145  Phagosome
rro04151  PI3K-Akt signaling pathway
rro04360  Axon guidance
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04514  Cell adhesion molecules
rro04530  Tight junction
rro04611  Platelet activation
rro04670  Leukocyte transendothelial migration
rro04810  Regulation of actin cytoskeleton
rro05100  Bacterial invasion of epithelial cells
rro05133  Pertussis
rro05135  Yersinia infection
rro05140  Leishmaniasis
rro05145  Toxoplasmosis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05222  Small cell lung cancer
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104663301 (ITGB1)
   04151 PI3K-Akt signaling pathway
    104663301 (ITGB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104663301 (ITGB1)
   04514 Cell adhesion molecules
    104663301 (ITGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    104663301 (ITGB1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104663301 (ITGB1)
   04530 Tight junction
    104663301 (ITGB1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104663301 (ITGB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104663301 (ITGB1)
   04670 Leukocyte transendothelial migration
    104663301 (ITGB1)
  09158 Development and regeneration
   04360 Axon guidance
    104663301 (ITGB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104663301 (ITGB1)
   05205 Proteoglycans in cancer
    104663301 (ITGB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104663301 (ITGB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104663301 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104663301 (ITGB1)
   05414 Dilated cardiomyopathy
    104663301 (ITGB1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104663301 (ITGB1)
   05133 Pertussis
    104663301 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    104663301 (ITGB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104663301 (ITGB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104663301 (ITGB1)
   05140 Leishmaniasis
    104663301 (ITGB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104663301 (ITGB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104663301 (ITGB1)
   04515 Cell adhesion molecules [BR:rro04515]
    104663301 (ITGB1)
   04090 CD molecules [BR:rro04090]
    104663301 (ITGB1)
Membrane trafficking [BR:rro04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    104663301 (ITGB1)
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104663301 (ITGB1)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin beta subunits
   104663301 (ITGB1)
CD molecules [BR:rro04090]
 Proteins
  104663301 (ITGB1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 104663301
NCBI-ProteinID: XP_010362739
UniProt: A0A2K6RRF7
LinkDB
Position
11
AA seq 801 aa
MNLQLIFWIGLISSICCVFGQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLV
LRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCE
ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CAQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVEN
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTQEN
PIYKSPINNFKNPNYGRKAGL
NT seq 2406 nt   +upstreamnt  +downstreamnt
atgaatttacaactgattttctggattggactgatcagttccatttgctgtgtgtttggt
caaacagatgaaaatagatgtttaaaagcaaatgccaaatcatgtggagaatgtatacaa
gcagggccaaattgtgggtggtgcacaaattcaacatttttacaggaaggaatgcccact
tctgcacgatgtgatgatttagaagccttaaaaaagaagggttgccctccagatgacata
gaaaatcccagaggctccaaagatataaagaaaaataaaaatgtaaccaaccgtagcaaa
ggaacagcagagaagctcaagccagaggatattactcagatccaaccacagcagttggtt
ttgcgattaagatcaggggagccacagacatttacattaaaattcaagagagctgaagac
tatcccattgacctctactaccttatggacctgtcttactcaatgaaagacgatttagag
aatgtaaaaagtcttggaacagatctgatgaatgaaatgaggaggattacttccgacttc
agaattggatttggttcatttgtggaaaagactgtgatgccttacattagcacaacacca
gctaagctcaggaacccttgcacaagtgaacagaactgcaccagcccatttagctacaaa
aatgtgctcagtctcactaataaaggagaagtatttaatgaacttgttggaaaacagcgc
atatctggaaatttggattctccagaaggtggtttcgatgccatcatgcaagttgcagtt
tgtggatcactgattggctggaggaatgttacacggctgctggtgttttccacagatgcc
gggtttcactttgctggagatgggaaacttggtggcattgttttaccaaatgatggacag
tgtcacctggaaaataatatgtatacaatgagtcattattatgattatccttctattgct
caccttgtccagaaactgagtgaaaataatattcagacaatttttgcagttactgaagaa
tttcagcccgtttacaaggaactgaaaaacttgatccctaagtcagcagtaggaacatta
tctgcaaattctagcaatgtaattcagttgatcattgatgcatacaattccctttcctca
gaagtcattttggaaaacggcaaattgtcagaaggagtaacaataagttacaaatcttac
tgcaagaacggggtgaatggaacaggggaaaatggaagaaaatgttccaatatttccatt
ggagatgaggttcaatttgaaattagcataacttcaaataagtgtccaaaaaaggattct
gacagctttaaaattaggcctctgggctttacggaggaagtagaggttattcttcagtac
atctgtgaatgtgaatgccaaagcgaaggcatccctgaaagtcccaagtgtcatgaagga
aacgggacgtttgagtgtggcgcgtgcaggtgcaacgaagggcgtgttggtagacattgt
gaatgcagcacagatgaagttaacagtgaagacatggacgcttactgcagaaaagaaaac
agttcagaaatctgcagtaacaatggagagtgcgtttgtggacagtgtgtttgtaggaag
agggataatacaaatgaaatttattctggcaaattctgcgagtgtgataatttcaactgt
gatagatccaatggcttaatttgtggaggaaatggtgtttgcaagtgtcgtgtgtgtgag
tgcaaccccaactacactggcagtgcgtgtgactgttctttggatactagtacttgcgaa
gccagcaacggacagatctgtaatggccggggcatctgcgaatgtggtgtctgtaagtgt
acagatccgaagttccaagggcaaacatgtgagatgtgtcagacctgccttggtgtctgt
gctgagcataaagaatgtgttcagtgcagagccttcaataaaggagaaaagaaagacaca
tgcgcacaggaatgttcctattttaacattaccaaggtagaaagtcgggacaaattaccc
cagccagtccaacctgatcctgtgtcccattgtaaggagaaggatgttgacgactgttgg
ttctattttacatattcagtgaatgggaacaatgaggtcatggttcatgttgtggagaat
ccagagtgtcccactggtccagacatcattccaattgtagctggtgtggttgctggaatt
gttcttattggccttgcattactgctgatatggaagcttttaatgattattcatgacaga
agggagtttgctaaatttgaaaaggagaaaatgaatgccaaatgggacacgcaagaaaat
ccgatttacaagagtcctattaataatttcaagaatccaaactacggacgtaaagctggt
ctctaa

DBGET integrated database retrieval system