KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663314
Entry
104663314         CDS       T03989                                 

Gene name
GNAQ
Definition
(RefSeq) guanine nucleotide-binding protein G(q) subunit alpha
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04062  Chemokine signaling pathway
rro04071  Sphingolipid signaling pathway
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04371  Apelin signaling pathway
rro04540  Gap junction
rro04611  Platelet activation
rro04713  Circadian entrainment
rro04720  Long-term potentiation
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04726  Serotonergic synapse
rro04728  Dopaminergic synapse
rro04730  Long-term depression
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04924  Renin secretion
rro04925  Aldosterone synthesis and secretion
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04929  GnRH secretion
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04961  Endocrine and other factor-regulated calcium reabsorption
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04972  Pancreatic secretion
rro05010  Alzheimer disease
rro05016  Huntington disease
rro05017  Spinocerebellar ataxia
rro05022  Pathways of neurodegeneration - multiple diseases
rro05135  Yersinia infection
rro05142  Chagas disease
rro05143  African trypanosomiasis
rro05146  Amoebiasis
rro05163  Human cytomegalovirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104663314 (GNAQ)
   04371 Apelin signaling pathway
    104663314 (GNAQ)
   04020 Calcium signaling pathway
    104663314 (GNAQ)
   04071 Sphingolipid signaling pathway
    104663314 (GNAQ)
   04022 cGMP-PKG signaling pathway
    104663314 (GNAQ)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104663314 (GNAQ)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104663314 (GNAQ)
   04062 Chemokine signaling pathway
    104663314 (GNAQ)
  09152 Endocrine system
   04911 Insulin secretion
    104663314 (GNAQ)
   04922 Glucagon signaling pathway
    104663314 (GNAQ)
   04929 GnRH secretion
    104663314 (GNAQ)
   04912 GnRH signaling pathway
    104663314 (GNAQ)
   04915 Estrogen signaling pathway
    104663314 (GNAQ)
   04921 Oxytocin signaling pathway
    104663314 (GNAQ)
   04935 Growth hormone synthesis, secretion and action
    104663314 (GNAQ)
   04918 Thyroid hormone synthesis
    104663314 (GNAQ)
   04928 Parathyroid hormone synthesis, secretion and action
    104663314 (GNAQ)
   04916 Melanogenesis
    104663314 (GNAQ)
   04924 Renin secretion
    104663314 (GNAQ)
   04925 Aldosterone synthesis and secretion
    104663314 (GNAQ)
   04927 Cortisol synthesis and secretion
    104663314 (GNAQ)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104663314 (GNAQ)
   04270 Vascular smooth muscle contraction
    104663314 (GNAQ)
  09154 Digestive system
   04970 Salivary secretion
    104663314 (GNAQ)
   04971 Gastric acid secretion
    104663314 (GNAQ)
   04972 Pancreatic secretion
    104663314 (GNAQ)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    104663314 (GNAQ)
  09156 Nervous system
   04724 Glutamatergic synapse
    104663314 (GNAQ)
   04725 Cholinergic synapse
    104663314 (GNAQ)
   04728 Dopaminergic synapse
    104663314 (GNAQ)
   04726 Serotonergic synapse
    104663314 (GNAQ)
   04720 Long-term potentiation
    104663314 (GNAQ)
   04730 Long-term depression
    104663314 (GNAQ)
   04723 Retrograde endocannabinoid signaling
    104663314 (GNAQ)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104663314 (GNAQ)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104663314 (GNAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104663314 (GNAQ)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104663314 (GNAQ)
   05016 Huntington disease
    104663314 (GNAQ)
   05017 Spinocerebellar ataxia
    104663314 (GNAQ)
   05022 Pathways of neurodegeneration - multiple diseases
    104663314 (GNAQ)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104663314 (GNAQ)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104663314 (GNAQ)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104663314 (GNAQ)
   05163 Human cytomegalovirus infection
    104663314 (GNAQ)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104663314 (GNAQ)
   05142 Chagas disease
    104663314 (GNAQ)
   05143 African trypanosomiasis
    104663314 (GNAQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104663314 (GNAQ)
   04031 GTP-binding proteins [BR:rro04031]
    104663314 (GNAQ)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104663314 (GNAQ)
GTP-binding proteins [BR:rro04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    104663314 (GNAQ)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29
Other DBs
NCBI-GeneID: 104663314
NCBI-ProteinID: XP_030775128
LinkDB
Position
16
AA seq 359 aa
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatcatggcgtgctgcctgagcgaggaggccaaggaagcccggcgg
atcaacgacgagatcgagcggcagctccgcagggacaagcgggacgcccgccgggagctc
aagctgctgcttctcgggacaggagaaagtggcaagagtacgtttatcaagcagatgaga
atcatccatgggtcaggatactctgatgaagataaaaggggcttcaccaagctggtgtat
cagaacatcttcacggccatgcaggccatgatcagagccatggacacactcaagatccca
tacaagtatgagcacaataaggctcatgcacaattagttcgagaagttgatgtggagaag
gtgtctgcttttgagaatccatatgtagatgcaataaagagtttatggaatgatcctgga
atccaggaatgctatgatagacgacgagaatatcaattatctgactctaccaaatactat
cttaatgacttggaccgcgtagctgaccctgcctacctgcctacgcaacaagatgtgctt
agagttcgagtccccaccacagggatcatcgaatacccctttgacttacaaagtgtcatt
ttcagaatggtcgatgtagggggccaaaggtcagagagaagaaaatggatacactgcttt
gaaaatgtcacctctatcatgtttctagtagcgcttagtgaatatgatcaagttctcgtg
gagtcagacaatgagaaccgaatggaggaaagcaaggctctctttagaacaattatcaca
tatccctggttccagaactcctcagttattctgttcttaaacaagaaagatcttctagag
gagaaaatcatgtattcccatctagttgactacttcccagaatatgatggaccccagaga
gatgcccaggcagcccgagaattcattctgaagatgttcgtggacctgaacccagacagt
gacaaaattatctactcccacttcacatgcgcgacagacaccgagaacatccgctttgtc
tttgctgccgtcaaggacaccatcctccagttgaacctgaaggagtacaatctggtctaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104665456
Entry
104665456         CDS       T03989                                 

Gene name
GNA11
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-11
  KO
K04635  guanine nucleotide-binding protein subunit alpha-11
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04270  Vascular smooth muscle contraction
rro04540  Gap junction
rro04725  Cholinergic synapse
rro04730  Long-term depression
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04925  Aldosterone synthesis and secretion
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04929  GnRH secretion
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro05142  Chagas disease
rro05146  Amoebiasis
rro05163  Human cytomegalovirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    104665456 (GNA11)
   04022 cGMP-PKG signaling pathway
    104665456 (GNA11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104665456 (GNA11)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    104665456 (GNA11)
   04929 GnRH secretion
    104665456 (GNA11)
   04912 GnRH signaling pathway
    104665456 (GNA11)
   04935 Growth hormone synthesis, secretion and action
    104665456 (GNA11)
   04928 Parathyroid hormone synthesis, secretion and action
    104665456 (GNA11)
   04925 Aldosterone synthesis and secretion
    104665456 (GNA11)
   04927 Cortisol synthesis and secretion
    104665456 (GNA11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104665456 (GNA11)
  09156 Nervous system
   04725 Cholinergic synapse
    104665456 (GNA11)
   04730 Long-term depression
    104665456 (GNA11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104665456 (GNA11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104665456 (GNA11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104665456 (GNA11)
   05163 Human cytomegalovirus infection
    104665456 (GNA11)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104665456 (GNA11)
   05142 Chagas disease
    104665456 (GNA11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104665456 (GNA11)
   04031 GTP-binding proteins [BR:rro04031]
    104665456 (GNA11)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104665456 (GNA11)
  Exosomal proteins of melanoma cells
   104665456 (GNA11)
GTP-binding proteins [BR:rro04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    104665456 (GNA11)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA AAA_29
Other DBs
NCBI-GeneID: 104665456
NCBI-ProteinID: XP_010365606
UniProt: A0A2K6PJ32
LinkDB
Position
8
AA seq 359 aa
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGAGYSEEDKRSFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEK
VTTFEHQYVSAIKTLWDDPGIQECYDRRREYQLSDSAKYYLTDVDRIATSGYLPTQQDVL
RVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatgatggcgtgttgcctcagcgatgaggtgaaggagtccaagcgg
atcaacgccgagatcgagaagcagctgcggcgggacaagcgcgacgcccggcgcgagctc
aagctgctgctgctcggcacgggcgagagcgggaagagcaccttcatcaagcagatgcgc
atcatccacggcgctggctactcagaggaggacaagcgcagcttcaccaagctcgtctac
cagaacatcttcaccgccatgcaggccatgatccgggccatggagacgctcaagatcctc
tacaagtacgagcagaacaaggccaatgcgctcctgatccgggaggtggacgtggagaag
gtgaccaccttcgagcatcagtacgtaagcgccatcaagaccctgtgggacgaccctggc
atccaggagtgctacgaccgcaggcgcgagtaccagctctccgactctgccaagtactac
ctgaccgatgttgaccgcatcgcaacctcgggctacctgcccacgcagcaggacgtgctg
cgggtccgcgtgcccaccaccggcatcatcgagtaccctttcgacctggagaacatcatc
ttcaggatggtggatgtgggcggccagcggtcggagcggaggaagtggatccactgcttt
gagaacgtgacatccatcatgtttctcgtcgccctcagcgagtacgaccaagtcctggtg
gagtcggacaatgagaaccggatggaggagagcaaagccctgttccggaccatcatcacc
tacccctggttccagaactcctccgtcatcctgttcctcaacaagaaggacctgctggag
gacaagatcctgtactcacacctggtggactacttccccgagttcgacgggccccagcgg
gacgcccaggcggcgcgggagttcatcctgaagatgttcgtggacctgaaccccgacagc
gacaagatcatctactcacacttcacgtgtgccaccgacacagagaacatccgcttcgtg
ttcgcggccgtgaaggacaccatcctgcagctcaacctcaaggaatacaacctggtctga

DBGET integrated database retrieval system