KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663473Help
Entry
104663473         CDS       T03989                                 

Definition
(RefSeq) histone H3.1
  KO
K11253  histone H3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro05034  Alcoholism
rro05202  Transcriptional misregulation in cancer
rro05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rro00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    104663473
  Immune diseases
   05322 Systemic lupus erythematosus
    104663473
  Substance dependence
   05034 Alcoholism
    104663473
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    104663473
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104663473
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 104663473
NCBI-ProteinID: XP_010362939
UniProt: A0A2K6NJG1
LinkDB All DBs
Position
Un
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtactaagcagaccgctcgtaaatccacaggcggtaaagcaccgcgcaagcag
ttggccactaaagcagctcgcaaaagcgctcctgccacgggtggcgtgaagaagcctcat
cgctaccgccctggtaccgtggctttgcgcgagatccgtcgctaccagaagtccaccgag
cttcttatccggaaactgccgtttcagcgcctagtgcgagaaatcgcccaggacttcaag
accgacctgcgctttcagagttccgctgtgatggcgctgcaggaggcctgcgaggcttac
ttggtggggctttttgaggacaccaacctgtgcgctatccatgccaaacgcgtcaccatc
atgcctaaggacatccagcttgcccgccgcattcgtggggagagagcgtaa

DBGET integrated database retrieval system