KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663504
Entry
104663504         CDS       T03989                                 

Gene name
TPM3
Definition
(RefSeq) tropomyosin alpha-3 chain isoform X5
  KO
K09290  tropomyosin 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro05200  Pathways in cancer
rro05216  Thyroid cancer
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104663504 (TPM3)
   04261 Adrenergic signaling in cardiomyocytes
    104663504 (TPM3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104663504 (TPM3)
  09162 Cancer: specific types
   05216 Thyroid cancer
    104663504 (TPM3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104663504 (TPM3)
   05414 Dilated cardiomyopathy
    104663504 (TPM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rro04812]
    104663504 (TPM3)
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     104663504 (TPM3)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CLZ TMF_DNA_bd ERM DUF745 Crescentin CENP-F_leu_zip XhlA DUF3450 ATG16 HrpB7 DHR10 DUF1664 SlyX Golgin_A5 Laminin_I AAA_13 DUF16 MAD
Other DBs
NCBI-GeneID: 104663504
NCBI-ProteinID: XP_010363015
UniProt: A0A2K6P5Y2
LinkDB
Position
8
AA seq 285 aa
MMEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEERSKQLEDELAAMQKKLKGTEDELDK
YSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKA
ADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERT
EERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRA
EFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSI
NT seq 858 nt   +upstreamnt  +downstreamnt
atgatggaggccatcaagaaaaagatgcagatgctgaagttagacaaggagaatgctctg
gatcgggcagagcaagctgaagctgagcagaagcaggcagaagaaagaagtaaacagctg
gaggatgagctggcagccatgcagaagaaactgaaagggacagaggatgagctggacaag
tattcagaagctttgaaggatgcccaggagaagctggaactggcagagaagaaggctgct
gatgctgaggctgaggtggcctccttgaatcgtaggatccagctggttgaagaggagctg
gaccgtgctcaggagcggctggccactgccctgcaaaaactggaagaagcagaaaaagct
gctgatgagagtgagagaggtatgaaggttattgaaaaccgggccttaaaagatgaagaa
aagatggaactccaggaaatccaactcaaagaagctaagcacattgcagaagaggcagat
aggaagtatgaagaggtggctcgtaagttggtgatcattgaaggagacttggaacgcaca
gaggaacgagctgagctggcagagtctaagtgttctgagctggaggaggagctgaagaat
gtcaccaacaacctcaagtctcttgaggctcaggcggagaagtactctcaaaaagaagac
aaatatgaggaagagatcaagattcttactgataaactcaaggaggcagagacccgtgct
gagtttgctgagagatcggtagccaagctggaaaagacaattgatgacttggaagatgag
ctctatgcccagaaactgaagtacaaggccattagcgaggaactggaccacgccctcaat
gacatgacctctatataa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664421
Entry
104664421         CDS       T03989                                 

Gene name
TPR
Definition
(RefSeq) nucleoprotein TPR
  KO
K09291  nucleoprotein TPR
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro03013  RNA transport
rro05014  Amyotrophic lateral sclerosis
rro05200  Pathways in cancer
rro05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    104664421 (TPR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104664421 (TPR)
  09162 Cancer: specific types
   05216 Thyroid cancer
    104664421 (TPR)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    104664421 (TPR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rro03019]
    104664421 (TPR)
Messenger RNA biogenesis [BR:rro03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     104664421 (TPR)
SSDB
Motif
Pfam: TPR_MLP1_2 Seryl_tRNA_N Crescentin DUF5082 DUF1192 Imm70
Other DBs
NCBI-GeneID: 104664421
NCBI-ProteinID: XP_010364215
LinkDB
Position
8
AA seq 2438 aa
MPSSGSVSRSRQRGRSMASRGFDGSRRGSLRRAGAREPPSEVEAAAQASGSSWSSPFFSA
STPSAAATGAPGPTDMAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEK
FKVESEQQYFEIEKRLSHSQERLVNETRECQSLRLELEKLSNQLKALTEKNKELEIAQDR
NIAIQSQFTRTKEELEAEKRDLIRTNERLSQELEYSTEDVKRLNEKLKESNTTKGELQLK
LDELQASDVSVKYREKRLEQEKELLHSQNTWLNTELKTKTDELLALGREKGNEILELKCN
LENKKEEVSRLEEQMNGLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELNAHIKL
SNLYKSAADDSEAKSNELTRAVDELHKLLKEAGEANKAIQDHLLEVEQSKDEMEKEMLEK
IGKLEKELENVNDLLSATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVET
QDQLLLEKLENKRINKYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSVKLEQAMKEI
QRLQEDTDKANKQSSVLERDNQRMEIQIKDLSQQIRVLLMELEEARGNHVIRDEEVSSAD
ISSSSEVISQHLVSYRNIEELQQQNQRLLVALRELGETREREEQETTSSKITELQLKLES
ALTELEQLRKSRQHQMQLVDSIVRQRDMYRILLSQTTGVAIPLHASSLDDISLASTPKRP
STSQTVATPAPVPVIESTEAIEAKAALKQLQEIFENYKKEKAENEKIQNEQLEKLQEQVT
DLRSQNTKISTQLDFASKRYEMLQDNVEGYRREITSLHERNQKLTATTQKQEQIINTMTQ
DLRGANEKLAVAEVRAENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTNLQTIQGI
LERSETETKQRLSSQIEKLEHEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDTETN
LHLNTKELFKNAQKEIATLKQHLSNMEVQLASQSSQRTGKGQPSNKEDVDDLVSQLRQTE
EQVNDLKERLKTSTSNVEQYRAMVTSLEESLNKEKQVTEEVRKNIEVRLKESAEFQTQLE
KKLMEVEKEKQELQDDKRRAIESMEQQLSELKKTLSSVQNEVQEALQRASTALSNEQQAR
RDCQEQAKIAVEAQNKYERELMLHAADVEALQAAKEQVSKMASVRQHLEETTQKAESQLL
ECKASWEERERMLKDEVSKCVCRCEDLEKQNRLLHDQIEKLSDKVVASVKEGVQGPLNVS
LSEEGKSQEQILEILRFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNAE
REKVQVTAKTMAQHEELMKKTETMNVVMETNKMLREEKERLEQDLQQMQAKVRKLELDIL
PLQEANAELSEKSGMLQAEKKLLEEDVKRWKARNQHLVSQQKDPDTEEYRKLLSEKEVHT
KRIQQLTEEIGRLKAEIARSNASLTNNQNLIQSLKEDLNKVRTEKETIQKDLDAKIIDIQ
EKVKTITQVKKIGRRYKTQYEELKAQQDKVMETSAQSSGDHQEQHVLVQEMQELKETLNQ
AETKSKSLESQVENLQKTLSEKETEARNLQEQSVQLQSELSRLRQDLQDRTTQEEQLRQQ
ITEKEEKTRKAIVAAKSKIAHLAGVKDQLTKENEELKQRNGALDQQKDELDVRITALKSQ
YEGRISRLERELREHQERHLEQRDEPQEPSNKVPEQQRQITLKTTPASGERGIASTSDPP
TANIKPTPVVSTPSKVTAAALAGNKSTPRASIRPMVTPATVTNPTTTPTATVMPTTQVES
QEAMQSEGPVEHVPVFGSTSGSVRSTSPNVQPSISQPILTVQQQTQATAFVQPTQQSHPQ
IEPVSQELSSNIVEVVQSSPVERPSTSTAVFGTVSATPSSSLPKRTREEEEDSTIEASDQ
VSDDTVEMPLPKKLKSVTPVGTEEEVMAEESTDGEVETQVYNQDSQDSIGEGVTQGDYTP
MEDSEETSQSLQIDLGPLQSDQQTTTSSQDGQGKGDDVIVIDSDDEEEDDDENDGEHEDY
EEDEEDDDDDEDDTGMGDEGEDSNEGTGSADGNDGYEADDAEGGDGTDPGTETEESMGGG
EGNQRAADSQNIGEGNTGAAESSFSQEVSREQQPSSASERQAPRAPQSPRRPPHPLPPRL
TIHAPPQELGPPVQRIQMTRRQSVGRGLQLTPGIGGMQQHFFDDEDRTVPSTPTLVVPHR
TDGFAEAIHSPQVAGVPRFRFGPPEDMPQTSSSHSDLGQLASQGGLGMYETPLFLAHEEE
SGGRSVPTTPLQVAAPVTVFTESTTSDASEHASQSVPMVTTSTGTLSTTNETATGDDGDE
VFVEAESEGISSEAGLEIDSQQEEEPVQASDESDLPSTSQDPPSSSSVDTSSSQPKPFRR
VRLQTTLRQGVRGRQFNRQRGVSHAMGGRGGINRGNIN
NT seq 7317 nt   +upstreamnt  +downstreamnt
atgccctctagtggctcagtgtccagaagccgccaaagaggacgatccatggcatcccgg
ggctttgatgggtcccgccgcgggagtctccggcgggcgggcgcgcgcgagcccccgagc
gaggtagaggcggcggcccaggcgtctgggtcctcctggtcttcgcctttcttctccgct
tctaccccgtcagccgctgccactggggcccctggccccaccgacatggcggctgtgttg
cagcaagtcctggagcgcacggagctgaacaagctgcccaagtctgtccagaacaaactt
gaaaagttccttgctgatcagcaatccgagatcgatggcctgaaggggcggcatgagaaa
tttaaggtggagagcgaacaacagtactttgaaatagaaaagaggttgtctcacagtcag
gagagacttgtgaatgaaacccgggagtgtcaaagcttgcggcttgagctagagaaactc
agcaatcagctgaaggcactaactgagaaaaacaaagaacttgaaattgctcaggatcgc
aatattgccattcagagccaatttacaagaacaaaggaagaattagaagctgagaaaaga
gacttaattagaaccaatgagagactatctcaagaacttgaatactcaacagaggatgtt
aaacgtctaaatgaaaaactaaaagaaagcaatacaacaaagggtgaacttcagttaaaa
ttggatgaacttcaagcatctgatgtttctgttaagtatcgagaaaaacgcttggagcaa
gaaaaggaattgctgcatagtcagaatacatggctgaatacagagttgaaaaccaaaact
gatgaacttctggcccttggaagagaaaaagggaatgagattctagagcttaaatgtaat
cttgaaaataaaaaagaggaggtttctagactggaagaacaaatgaatggcttaaaaaca
tcgaatgaacatcttcaaaagcatgtggaggatctgttgaccaaattaaaagaggccaag
gaacaacaggccagtatggaagagaaattccacaatgaattaaatgcacacataaaactt
tctaacttgtacaagagtgccgctgatgactcagaagcaaagagcaatgaactaacccgg
gcagtagatgaactacacaaacttttgaaagaagctggtgaagccaacaaagcaatacaa
gatcatcttctagaggtggagcaatccaaagatgaaatggaaaaagaaatgctcgagaaa
atagggaaactggaaaaggaattagagaatgtaaatgaccttctttctgccacaaaacgt
aaaggagccatattgtctgaagaagagcttgcagccatgtctcctactgcagcagctgta
gctaagatagtgaaacctgggatgaaactaactgagctctataatgcttatgtggaaact
caggatcagttgcttttggagaaactagagaacaaaagaattaataagtacctagatgaa
atagtgaaagaagtggaagccaaagcaccaattttgaaacgccagcgtgaggaatatgaa
cgtgcccagaaagctgtagcaagtttatctgttaagcttgaacaagctatgaaggagatt
cagcgattgcaggaggatactgataaagccaacaagcagtcatctgtactggagagagat
aatcaaagaatggaaatacaaataaaagatctttcacaacagattagagtgcttttgatg
gaacttgaagaagcaaggggtaaccacgtaattcgtgatgaggaagtaagctctgctgat
ataagtagttcatctgaagtaatatcacagcatctagtatcttacagaaatattgaagag
cttcaacaacaaaatcaacgtctgttggtggcccttagagagcttggggaaaccagagaa
agagaagaacaagaaacaacttcatccaaaatcactgagcttcagctcaaacttgagagt
gccctcactgaactcgaacaactccgcaaatcacgacagcatcaaatgcagcttgttgat
tccatagttcgtcagcgtgatatgtaccgtattttattgtcccaaacaaccggagttgcc
attccattacatgcgtcaagcttagatgatatttctcttgcatcaactccaaaacgtcca
agtacatcacagactgttgccactcctgctccagtacctgttattgaatcaacagaggct
atagaggctaaggctgcccttaaacagttgcaggaaatttttgagaactacaaaaaagaa
aaagcagaaaatgaaaaaatacaaaatgagcagcttgagaaacttcaagaacaagttaca
gatttgcgatcacaaaataccaaaatttctacccagctagattttgcttctaaacgttat
gaaatgctgcaagataacgttgaaggatatcgtcgagaaataacatcacttcatgagaga
aatcagaaactcactgccacgactcaaaagcaagaacagattatcaatacgatgactcaa
gatttgagaggagcaaatgagaagctagctgtcgcagaagtaagagcagaaaatttgaag
aaggaaaaggaaatgcttaaattgtctgaagttcgtctttctcagcaaagggagtctttg
ttagctgaacaaagggggcaaaacttattgctaactaatctgcaaacaattcagggaata
ctggagcgatctgaaacagaaaccaaacaaagacttagtagccagatagaaaaactggaa
catgagatctctcatctaaagaagaagttggaaaatgaggtggaacaaaggcatacactt
actagaaatctagatgttcaacttttagatacaaagagacaactggatacagagacaaat
cttcatcttaacacaaaagaactatttaaaaatgctcaaaaagaaattgctacattgaaa
cagcacctcagtaatatggaagtccaacttgcttctcagtcttcacagagaactggtaaa
ggtcagcctagcaacaaagaagatgtagatgatcttgtgagtcagctaagacagacagaa
gagcaggtgaatgacttaaaggagagactcaaaacaagtactagcaatgtagaacaatat
cgagcaatggttactagtttagaagaatccctgaacaaggaaaaacaggtgacagaagaa
gtgcgtaagaatattgaagttcgtttaaaagagtcagctgagtttcagacacagttggaa
aagaagttgatggaagtagagaaggaaaaacaagaacttcaggatgataagagaagagcc
atagagagcatggaacaacagttatctgaattgaaaaaaacactttctagtgttcagaat
gaagtacaagaagctcttcagagagcaagcacagctttaagtaatgagcagcaagccaga
cgtgactgtcaggaacaagctaaaatagctgtggaagctcagaataagtatgagagagaa
ttgatgctgcatgctgctgatgttgaagctctacaagctgcgaaggagcaggtttcaaaa
atggcatcagtccgtcagcatttggaagaaacaacacagaaagcagaatcacagttgttg
gagtgtaaagcatcttgggaagaaagagagagaatgttaaaggatgaagtttccaaatgt
gtatgtcgctgtgaagatctggagaaacaaaacagattacttcatgatcagatcgaaaaa
ttaagtgacaaggtcgttgcctctgtgaaggaaggtgtacaaggaccactgaatgtatct
ctcagtgaagaaggaaaatctcaagaacaaattttggaaattctcagatttatacgacga
gaaaaagaaattgctgaaactaggtttgaggtggctcaggttgagagtctgcgttatcga
caaagggttgaacttttagaaagagagctgcaggaactgcaagatagtctaaatgctgaa
agggagaaagtccaggtaactgcaaaaacaatggctcagcatgaagaactgatgaagaaa
actgaaacaatgaatgtagttatggagaccaataaaatgctaagagaagaaaaggagaga
ctagaacaggatctacagcaaatgcaagcaaaggtaagaaaactggagttagatatttta
cccttacaagaagcaaatgctgagctgagtgagaaaagcggtatgttgcaggcagagaag
aagctgttggaagaggatgtcaaacgttggaaagcacgtaaccagcatctagtaagtcaa
cagaaagatccagatacagaagaatatcggaagctcctttctgaaaaggaagttcatact
aagcgtattcaacagttgacagaagaaattggtagacttaaagctgaaattgcaagatca
aatgcatctttgactaacaaccagaacttaattcagagtctgaaggaagatctaaataaa
gtaagaactgaaaaggaaaccatccagaaggacttagatgccaaaataattgatatccaa
gaaaaagtcaaaactattactcaagtaaagaaaattggacgtaggtacaagactcaatat
gaagaacttaaagcacaacaagataaggttatggagacatcggctcagtcctctggagac
catcaggaacagcatgttttagtccaggaaatgcaggaactcaaagaaacactcaaccaa
gctgaaacaaaatcaaaatcactcgagagtcaagtagagaatctgcagaagacattatct
gaaaaagagacagaagcaagaaatctccaggaacagagtgtgcaacttcagtctgaactt
tcacgacttcgtcaggatcttcaagatagaaccacacaggaggagcagctccgacaacag
ataactgaaaaggaagaaaaaaccagaaaggctattgtagcagcaaaatcaaaaattgca
cacttagctggtgtaaaagatcagctaactaaagaaaatgaggagcttaaacaaaggaat
ggagccttagatcagcagaaagacgaattggatgttcgtattactgctctaaagtcccaa
tatgaaggtcgaattagtcgcttggaaagagaactcagggagcatcaagagagacacctt
gagcagagagatgagcctcaagaaccttctaataaggtccctgaacagcagagacagatc
acgttgaaaacaactccagcttctggtgaaagaggaattgccagcacatcagacccacca
acagccaatatcaagccaactcctgttgtgtctactccaagtaaagtgacagctgcagct
ttggctggaaataagtcaacacccagggctagtatccgcccaatggttacacctgcaact
gttacaaatcccactactaccccaacagctacagtgatgcccactacacaagtggaatca
caggaagctatgcagtcagaagggcctgtggaacatgttccagtttttggaagcacaagt
ggatccgttcgttctactagtcctaatgtccagccttctatatctcaacctattttaact
gttcagcaacaaacacaggctacagcttttgtgcaacccacccaacagagtcatcctcag
attgagcctgtcagtcaggagttatcttcaaacatagtagaggttgttcagagttcacca
gttgagcggccttctacttccacagcagtatttggcacagtttcggctacccccagttct
tctttgccaaagcgtacacgtgaagaggaagaggatagcaccatagaagcatcagaccaa
gtctctgatgatacagtggaaatgcctcttccaaagaagttgaaaagcgttacacccgta
ggaactgaggaagaagttatggcagaagaaagtactgatggagaggtggagactcaggta
tacaaccaggattctcaagattctattggagaaggagttacccagggagattatacacct
atggaagacagtgaagaaacctctcagtctctacaaatagatcttggaccacttcaatca
gatcagcaaacaacaacttcatcccaggatggtcaaggcaaaggagatgatgtcattgta
attgacagtgatgatgaagaagaggatgatgatgaaaatgatggagaacatgaggattat
gaagaggatgaggaagatgatgatgatgatgaagatgacacagggatgggagacgagggt
gaagatagtaatgaaggaactggtagtgccgatggcaatgatggttatgaagctgatgat
gctgagggtggcgatgggactgatccaggtacagaaacagaagaaagtatgggtggaggt
gaaggtaatcagagagctgctgattctcaaaacattggtgaaggaaatacaggtgctgca
gaatcttccttttctcaggaggtttctagagaacaacagccatcatcagcatctgaaaga
caggcccctcgagcacctcagtcacctagacgcccaccacatccacttcccccaagactg
accattcatgctccacctcaggagttgggaccaccagttcagagaattcagatgacccga
aggcagtctgtaggacgtgggcttcagttgactccaggaataggtggcatgcaacagcat
ttttttgatgatgaagacagaacagttccaagtactccaactcttgtggtgccacatcgt
actgatggatttgctgaagcaattcattcaccacaggttgctggtgtccctagattccgg
tttgggccacctgaagatatgccacaaacaagttctagtcactctgatcttggccagctt
gcttctcaaggaggtttaggaatgtacgaaacacccctgttcctagctcatgaagaagag
tcaggtggccgaagtgttcccactactccactacaagtagcagccccagtgactgtattt
actgagagcaccacctctgatgcttcggaacatgcctctcaatctgttccaatggtgact
acatccactggcactttatctacaacaaatgaaacagcaacaggtgatgatggagatgaa
gtatttgtggaggcagaatctgaaggtattagttcagaagcaggcctagaaattgatagc
cagcaggaggaagagccagttcaagcatctgatgagtcagatctcccctccaccagccag
gatcctccttctagctcatctgtagatacaagtagtagtcaaccaaagcctttcagacga
gtaagacttcagacaacattgagacaaggtgtccgtggtcgtcagtttaacagacagaga
ggtgtgagccatgcaatgggagggagaggaggaataaatagaggaaatattaattaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104666712
Entry
104666712         CDS       T03989                                 

Gene name
TFG
Definition
(RefSeq) protein TFG isoform X1
  KO
K09292  protein TFG
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro05200  Pathways in cancer
rro05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104666712 (TFG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    104666712 (TFG)
SSDB
Motif
Pfam: PB1
Other DBs
NCBI-GeneID: 104666712
NCBI-ProteinID: XP_010367148
UniProt: A0A2K6PC40
LinkDB
Position
1
AA seq 400 aa
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKD
EDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLL
DSLEPPGELGPSTNIPENDTVDGREEKPASDSSGKQSTQVMAASMSAFDPLKNQDEINKN
VMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQIE
GQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQTGPQQPQQFQGYGQQPTSQAP
APAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMAPSQPGAYQPR
PGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgaacggacagttggatctgagtgggaagctaatcatcaaagctcaacttggggaggat
attcggcgaattcctattcataatgaagatattacttatgatgaattagtgctaatgatg
cagcgagttttcagaggaaagcttctgagtaatgatgaagtaacaataaagtataaagat
gaagatggagatcttataacaatttttgatagttctgacctttcctttgcaattcagtgt
agtaggatactgaaactaacattatttgttaatggccaaccaagaccccttgaatcaagt
caggtcaaatatctccgtcgagaactgatagaacttcgaaataaagtgaatcgtttattg
gatagcttggaaccacctggagaacttggaccttccaccaatattcctgaaaatgatact
gtggatggtagggaagaaaagcctgcttctgattcttctggaaaacagtctactcaggtt
atggcagcaagtatgtctgcttttgatcctttaaaaaaccaagatgaaatcaataaaaat
gttatgtcagcgtttggcttaacagatgatcaggtttcagggccacccagtgctcctgca
gaagatcgttcaggaacacccgacagcattgcttcctcctcctcagcagctcacccacca
ggagttcagccacagcaaccaccatacacgggagctcagacacaagcaggtcagattgaa
ggtcagatgtaccaacagtaccagcaacaggccggctatggtgcgcagcagccgcaggct
ccacctcagcagcctcaacagtatggtattcagtattcagcaagctatagtcagcagact
ggaccccaacaacctcagcagttccagggatatggccagcaaccaacttcccaggcacca
gctcctgccttttctggtcagcctcaacaactgcctgctcagccgccacagcagtaccag
gcgagcaattatcctgcacaaacttacactgcccaaacttctcagcctactaattatact
gtggctcctgcctcccaacctggaatggctccaagccaacctggggcctatcaaccaaga
ccaggttttacttcacttcctggaagtaccatgacccctcctccaagtgggcctaatcct
tatgcacgtaaccgtcctccctttggtcagggctatacccaacctggacctggttatcga
taa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104676442
Entry
104676442         CDS       T03989                                 

Gene name
NTRK1
Definition
(RefSeq) high affinity nerve growth factor receptor
  KO
K03176  neurotrophic tyrosine kinase receptor type 1 [EC:2.7.10.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04014  Ras signaling pathway
rro04020  Calcium signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04210  Apoptosis
rro04722  Neurotrophin signaling pathway
rro04750  Inflammatory mediator regulation of TRP channels
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05216  Thyroid cancer
rro05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104676442 (NTRK1)
   04014 Ras signaling pathway
    104676442 (NTRK1)
   04020 Calcium signaling pathway
    104676442 (NTRK1)
   04151 PI3K-Akt signaling pathway
    104676442 (NTRK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104676442 (NTRK1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104676442 (NTRK1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104676442 (NTRK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104676442 (NTRK1)
   05202 Transcriptional misregulation in cancer
    104676442 (NTRK1)
   05230 Central carbon metabolism in cancer
    104676442 (NTRK1)
  09162 Cancer: specific types
   05216 Thyroid cancer
    104676442 (NTRK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104676442 (NTRK1)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     104676442 (NTRK1)
Protein kinases [BR:rro01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   104676442 (NTRK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TPKR_C2 LRR_8 I-set TrkA_TMD Ig_3 Ig_2 LRR_4
Other DBs
NCBI-GeneID: 104676442
NCBI-ProteinID: XP_010379586
LinkDB
Position
8
AA seq 816 aa
MSGEARQQQLRAHRRLPRRSKAGAAAMLQGGRRGQLGWHSWAAGPGSLLAWLMLASAGAS
PCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQHLQHLELRDLRGLGELR
NLTIVKSGLRLVAPDAFHFTPRLSHLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSC
ALRWLQRWEEEGLGGVHEQKLQCHGQGPLAHMPNASCGVPMLKVQVPNASVDVGDDVLLW
CQVEGRGLEQAGWILTELEQSATVMKSGALPSLGLTLANVTSDLNRKNVTCWAENDVGRA
EVSVQVNVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLE
PAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPDT
NSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSMLLLVLNKCGRRNKFGINRPAVLAPED
GLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGA
FGKVFLAECHNLLPEQDKMLVAVKALKEVSESARQDFQREAELLTMLQHQHIVRFFGVCT
EGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLVGGEDVAPGPLGLGQLLAVASQVAAGMVY
LAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESIL
YRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIM
RGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgtcgggggaggcccggcagcagcagctgagagcgcacagacggctgccccgccggagc
aaggcgggcgccgccgcgatgctgcaaggcggacggcgcgggcagcttggctggcacagc
tgggctgcggggccgggcagcctgctggcttggctgatgttggcatctgcgggcgcctca
ccctgccccgatgcctgctgcccccacggctcctcgggactgcgatgcacacgggatggg
gccctggatagcctccaccacctgcccggcgcagagaacctgactgagctctacatcgag
aaccagcagcatctgcagcatctggagctccgtgacctgaggggcctgggggagctgaga
aacctcaccatcgtgaagagtggtctccgtttagtggcgccagatgccttccatttcact
cctcggctcagtcacctgaatctctccttcaatgctctggagtctctctcctggaaaact
gtgcagggcctctccttacaggaactggtcctgtcggggaaccctctgcactgttcctgt
gccctgcgctggctacagcgctgggaggaggagggactgggcggagtgcatgaacagaag
ctgcagtgtcatgggcaagggcccctggcccatatgcccaatgccagctgtggtgtgcct
atgctgaaggtccaggtgcccaacgcctccgtggatgtgggggacgatgtgctgctgtgg
tgccaggtggaggggcggggcctggagcaggccggctggatcctcacggagctggagcag
tcagccacagtgatgaaatctggggctctgccgtccctggggctgaccctggccaatgtc
accagtgatctcaacaggaagaacgtgacgtgctgggcagagaatgatgtaggccgggca
gaggtctctgttcaggtcaacgtctccttcccggccagtgtgcagctgcacacggcggtg
gaaatgcaccactggtgcatccccttctctgtggatgggcagccggcaccgtctctgcgc
tggctcttcaatggctccgtgctcaatgagaccagcttcatcttcaccgagttcctggag
ccggcggccaatgagactgtgcggcacgggtgtctgcgcctcaaccagcccacccacgtc
aacaacggcaactacacgctgctggctgccaaccccttcggccaggcgtccgcctccatc
atggctgccttcatggacaaccctttcgagttcaaccccgaggaccccatccctgatact
aacagcacatctggagacccggtggagaagaaggatgaaacaccttttggggtctcggtg
gctgtgggcctggccgtctttgcctgcctcttcctttctatgctgctccttgtgctcaac
aaatgcggaaggagaaacaagtttgggatcaaccgcccggctgtcctggctccagaggac
gggctggccatgtccctgcatttcatgacattgggtggcagctccctgtcccccaccgag
ggcaaaggctctgggctccaaggccacatcatcgagaacccgcaatacttcagtgatgcc
tgtgttcaccacatcaagcgccgggacatcgtgctcaagtgggagctgggggagggcgcc
tttgggaaggtcttccttgctgagtgccacaaccttctgcctgagcaggacaagatgctg
gtggctgtcaaggcactgaaggaggtgtccgagagtgctcggcaggacttccagcgcgag
gccgagctgctcaccatgctgcagcaccagcacattgtgcgcttcttcggcgtctgcacc
gagggccgccccctgctcatggtctttgagtatatgcggcatggggacctcaaccgcttc
ctccgatcccatgggcctgatgccaagctgctggttggtggggaggatgtggctccaggc
cccctgggtctggggcagctgctggccgtggctagccaggtcgctgcggggatggtgtac
ctggcaggtctgcattttgtgcaccgggacctggccacacgcaactgtctggtgggccaa
ggactggtggtcaagattggtgatttcggcatgagcagggatatctacagcaccgactat
taccgtgtgggaggccgcaccatgctgcccatccgctggatgccgcctgagagcatcctc
taccgcaagttcaccactgagagtgacgtgtggagcttcggcgtggtgctctgggagatc
ttcacctacggcaaacagccctggtaccagctctccaacactgaggcaatcgactgcatc
acgcagggacgtgagttggagcggccacgtgcctgcccaccagaggtctacgccatcatg
cggggctgctggcagcgggagccccagcaacgccacagcatcaaggacgtgcacgcccgg
ctgcaagccctggcccaggcacctccggtctacctggacgtcctgggctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104677298
Entry
104677298         CDS       T03989                                 

Definition
(RefSeq) tropomyosin alpha-3 chain-like isoform X1
  KO
K09290  tropomyosin 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro05200  Pathways in cancer
rro05216  Thyroid cancer
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104677298
   04261 Adrenergic signaling in cardiomyocytes
    104677298
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104677298
  09162 Cancer: specific types
   05216 Thyroid cancer
    104677298
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104677298
   05414 Dilated cardiomyopathy
    104677298
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rro04812]
    104677298
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     104677298
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II TMF_DNA_bd CENP-F_leu_zip CLZ EzrA DUF745 SNARE DUF1664 MAD BORCS7 Fib_alpha Lebercilin Crescentin CALCOCO1
Other DBs
NCBI-GeneID: 104677298
NCBI-ProteinID: XP_010380576
LinkDB
Position
10
AA seq 248 aa
MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVE
EELDRAQERLATALQKLEEAEKAADKSERGMKVIENWALKDEEKMELQEIQLKEAKHIAE
EADRKYEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQ
KEDKYEEEIKILTDKLKEAETHAEFAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQ
TLLDLNEM
NT seq 747 nt   +upstreamnt  +downstreamnt
atggctgggatcaccaccatcgaggcggtgaagcgcaagatccaggttctgcagcagcag
gcagatgatgcagaggagcgagctgagcgcctccaacgagaagttgagggagaaaggagg
gctcgggaacaggctgaggctgaggtggcctccttgaatcgtaggatccagctggttgaa
gaggagctggaccgtgctcaggagcggctggccactgccctgcaaaaactggaagaagcg
gaaaaagctgctgataagagtgagagaggtatgaaggttattgaaaactgggccttaaaa
gatgaagaaaagatggaactccaggaaatccaactcaaagaagctaagcacattgcagaa
gaggcagataggaagtatgaagaggtggctcgtaagttggtgatcattgaaggagacttg
gaacgcacagaggaacgagctgagctggcagagtcccgttgccgagagatggatgagcag
attagactgatggaccagaacctgaagtgtctgagtgctgctgaagaaaagtactctcaa
aaagaagacaaatatgaggaagagatcaagattcttactgataaactcaaggaggcagag
acccatgctgagtttgctgagagatcggtagccaagctggaaaagacaattgatgacttg
gaagataaactgaaatgcaccaaagaggagcacctctgtacacaaaggatgctggaccag
actctgcttgacctgaatgagatgtag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 115898675
Entry
115898675         CDS       T03989                                 

Definition
(RefSeq) tropomyosin alpha-3 chain-like isoform X1
  KO
K09290  tropomyosin 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro05200  Pathways in cancer
rro05216  Thyroid cancer
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    115898675
   04261 Adrenergic signaling in cardiomyocytes
    115898675
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    115898675
  09162 Cancer: specific types
   05216 Thyroid cancer
    115898675
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    115898675
   05414 Dilated cardiomyopathy
    115898675
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rro04812]
    115898675
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     115898675
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II TMF_DNA_bd CENP-F_leu_zip DHR10 WES_acyltransf BORCS7 Lebercilin MAD DUF1664 V_ATPase_I CLZ
Other DBs
NCBI-GeneID: 115898675
NCBI-ProteinID: XP_030789803
LinkDB
Position
7
AA seq 248 aa
MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAWEQAEAEVASLNRRIQLVE
EELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAE
EADRKYEEVARKLVIIEGVLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQ
KEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQ
TLLDLNEM
NT seq 747 nt   +upstreamnt  +downstreamnt
atggctgggatcaccaccatcgaggcggtgaagcgcaagatccaggttctgcagcagcag
gcagatgatgcagaggagcgagctgagcgcctccaacgagaagttgagggagaaaggcgg
gcttgggaacaggctgaggctgaggtggcctccttgaatcgtaggatccagctggttgaa
gaggagctggaccgtgctcaggagcggctggccactgccctgcaaaaactggaagaagcg
gaaaaagctgctgatgagagtgagagaggtatgaaggttattgaaaaccgggccttaaaa
gatgaagaaaagatggaactccaggaaatccaactcaaagaagctaagcacattgcagaa
gaggcagataggaagtatgaagaggtggctcgtaagttggtgatcattgaaggagtcttg
gaacgcacagaggaacgagctgagctggcagagtcccgttgccgagagatggatgagcag
attagactgatggaccagaacctgaagtgtctgagtgctgctgaagaaaagtactctcaa
aaagaagacaaatatgaggaagagatcaagattcttactgataaactcaaggaggcagag
acccgtgctgagtttgctgagagatcggtagccaagctggaaaagacaattgatgacttg
gaagataaactgaaatgcaccaaagaggagcacctctgtacacaaaggatgctggaccag
actctgcttgacctgaatgagatgtag

DBGET integrated database retrieval system