KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663542
Entry
104663542         CDS       T03989                                 

Gene name
EMD
Definition
(RefSeq) emerin
  KO
K12569  emerin
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104663542 (EMD)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104663542 (EMD)
   05414 Dilated cardiomyopathy
    104663542 (EMD)
SSDB
Motif
Pfam: LEM DUF5542 Orf78
Other DBs
NCBI-GeneID: 104663542
NCBI-ProteinID: XP_010363091
LinkDB
Position
7
AA seq 258 aa
MDDYADLSNTELTALLRRYNIPHGPVVGSTRRLYEQKIFEYETQRRRLSPPGSSAASSYR
FSDLNSTSGDSDMYDLPKKEDALLYQSKGYNDDYYEESYFTTRTYGEPESAGPSRGFRQS
VTSLPDADTFHHQVRDDDLLSSSEEECKDRERPMYSRDSAYQSIAHYRPVSASRSSLDLS
YYPTSSSTSSMSSSSSSSSWLTRRAIRPENHAPGAGLGQDHQVPLWGQLLLFLVFVIVLF
FIYYFMQAEEGNPFQREP
NT seq 777 nt   +upstreamnt  +downstreamnt
atggacgactacgcagatctttccaataccgagctgaccgccttgctgcgccggtacaac
atcccgcacgggcctgtagtaggatcaactcgtaggctttacgagcagaagatcttcgag
tacgagacccagaggcggcggctctcgccccccggctcgtccgctgcctcctcttaccgc
ttctctgacttgaattcgacgtcaggggattcagatatgtatgatcttcccaagaaagag
gacgccttactctaccagagcaagggctacaatgacgactactatgaagagagctacttc
actaccaggacttatggggagcccgagtctgcgggcccgtccaggggcttccgccagtct
gtgacttcactcccagatgctgacactttccaccaccaggtgcgtgatgacgatcttttg
tcgtcttctgaagaggagtgcaaggatagggaacgccccatgtacagccgggacagtgcc
taccagagcattgcgcactaccgccctgtttcagcctccaggagttccctggacctgtcc
tattatcctacttcctcctccacctcttctatgtcctcctcatcatcttcctcttcatgg
ctcacccgccgtgccatccggcctgaaaaccatgctcctggggctgggctgggccaggat
caccaggtcccgctctggggccagctgctgcttttcctggtctttgtgatcgtcctcttc
ttcatttactactttatgcaggctgaggaaggcaaccctttccagagggagccgtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682784
Entry
104682784         CDS       T03989                                 

Definition
(RefSeq) emerin
  KO
K12569  emerin
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104682784
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104682784
   05414 Dilated cardiomyopathy
    104682784
SSDB
Motif
Pfam: LEM DUF5542 Orf78
Other DBs
NCBI-GeneID: 104682784
NCBI-ProteinID: XP_010387824
LinkDB
Position
6
AA seq 258 aa
MDDYADLSNTQLTALLRRYNIPHGPVVGSTRRLYEQKIFEYETQRRRLSPSGSPAASSYR
FSDLNSTSGDSDMYDLPKKKDALLYQSKDYNDDYYEESYFTTRTYGEPESPGPSRGFRQS
VTSLPDADTFHHQVRDDDLLSSSEEECKDRERPMYGRDSAYQSIAHYSPVSASGSSLDLS
YYPTSSSTSSSSSASSSSSWLTSRAIRPENHAPGAGLGQDHQVPLWGQLLLFLVFVMIVF
FIYYFMQAEEGNPFQREP
NT seq 777 nt   +upstreamnt  +downstreamnt
atggacgactacgcagatctttcaaatacccagctgaccgccttgctgcgccggtacaac
atcccgcacgggcctgtagtaggatcaactcgtaggctttacgagcagaagatcttcgag
tacgagacccagaggcggcggctctcgccctccggctcgcccgctgcctcctcttatcgc
ttctctgacttgaattcgacgtcaggggattcagatatgtatgatcttcccaagaaaaag
gacgccttactctaccagagcaaggactacaatgacgactactatgaagagagctacttc
actaccaggacttatggggagcccgagtctccgggcccgtccaggggcttccgccagtct
gtaacttcactcccagatgctgacactttccaccaccaggtgcgtgatgacgatcttttg
tcgtcttctgaagaggagtgcaaggatagggaacgccccatgtatggccgggacagtgcc
taccagagcatcgcgcactacagccctgtttcagcctccgggagctccctggacctgtcc
tattatcctacatcctcctccacctcttcctcgtcctccgcatcatcttcctcttcatgg
ctcaccagccgtgccatccggcctgaaaaccatgctcctggggctgggctgggccaggat
caccaggtcccgctctggggccagctgctgcttttcctggtctttgtgatgatcgtcttc
ttcatttactacttcatgcaggctgaggaaggcaaccctttccagagagagccgtga

DBGET integrated database retrieval system