KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663679
Entry
104663679         CDS       T03989                                 

Gene name
CDK1
Definition
(RefSeq) cyclin-dependent kinase 1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04110  Cell cycle
rro04114  Oocyte meiosis
rro04115  p53 signaling pathway
rro04218  Cellular senescence
rro04540  Gap junction
rro04914  Progesterone-mediated oocyte maturation
rro05170  Human immunodeficiency virus 1 infection
rro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104663679 (CDK1)
   04114 Oocyte meiosis
    104663679 (CDK1)
   04115 p53 signaling pathway
    104663679 (CDK1)
   04218 Cellular senescence
    104663679 (CDK1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104663679 (CDK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    104663679 (CDK1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104663679 (CDK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104663679 (CDK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104663679 (CDK1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rro03032]
    104663679 (CDK1)
   03036 Chromosome and associated proteins [BR:rro03036]
    104663679 (CDK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104663679 (CDK1)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     104663679 (CDK1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     104663679 (CDK1)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: CMGC group
  CDK family
   104663679 (CDK1)
DNA replication proteins [BR:rro03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    104663679 (CDK1)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104663679 (CDK1)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104663679 (CDK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like Kdo Seadorna_VP7 Choline_kinase
Other DBs
NCBI-GeneID: 104663679
NCBI-ProteinID: XP_010363257
UniProt: A0A2K6RH32
LinkDB
Position
11
AA seq 297 aa
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDVDNQIKKM
NT seq 894 nt   +upstreamnt  +downstreamnt
atggaagattataccaaaatagagaaaattggagaaggtacctatggagttgtgtataag
ggtagacacaaaactacaggtcaagtggtagccatgaaaaaaatcagactagaaagtgaa
gaggaaggggttcctagtactgcaattcgggaaatttctctattaaaagaacttcgtcat
ccaaatatagtcagtcttcaggatgtgcttatgcaggattccaggttatatctcatcttt
gagtttctttccatggatctgaagaaatacttggattctatccctcctggtcagtacatg
gattcttcactcgttaagagttatttataccaaatcctacaggggattgtgttttgtcac
tctagaagagttcttcacagagacttaaaacctcaaaatctcttgattgatgacaaagga
acaattaaactggctgattttggccttgccagagcttttggaatacctattagagtatat
acacatgaggtagtaacactctggtacagatctccagaagtattgctggggtcagctcgt
tactcaactccagttgacatttggagtataggcaccatatttgctgaactagcaactaaa
aaaccacttttccatggggattcagaaattgatcaactcttcaggattttcagagctttg
ggcactcccaataatgaagtgtggccagaagtggaatctttacaggactataagaataca
tttcccaaatggaaaccaggaagcctagcatcccatgtcaaaaacttggatgaaaatggc
ttggatttgctctcgaaaatgttaatctatgatccagccaaacgaatttctggcaaaatg
gcactgaatcatccatattttaatgatgtggacaatcagattaagaagatgtag

DBGET integrated database retrieval system