KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663739
Entry
104663739         CDS       T03989                                 

Gene name
AQP1
Definition
(RefSeq) aquaporin-1
  KO
K09864  aquaporin-1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04924  Renin secretion
rro04964  Proximal tubule bicarbonate reclamation
rro04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    104663739 (AQP1)
  09154 Digestive system
   04976 Bile secretion
    104663739 (AQP1)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    104663739 (AQP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rro02000]
    104663739 (AQP1)
   04147 Exosome [BR:rro04147]
    104663739 (AQP1)
Transporters [BR:rro02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    104663739 (AQP1)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104663739 (AQP1)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 104663739
NCBI-ProteinID: XP_010363369
UniProt: A0A2K6N818
LinkDB
Position
6
AA seq 269 aa
MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPLGNNQTAVQDNVKVSLAFGLSI
ATLAQSVGHISGAHLNPAVTLGLLLSCQISIFRALMYIIAQCVGAIVATAILSGITSSLP
GNSLGRNDLADGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGH
LLAIDYTGCGINPARSFGSAVITHNFSNHWIFWVGPFIGAALAVLIYDFILAPRSSDFTD
RVKVWTSGQVEEYDLDADDINSRVEMKPK
NT seq 810 nt   +upstreamnt  +downstreamnt
atggccagcgagttcaagaagaagctcttctggagggcagtggtggccgagttcctggcc
acgaccctctttgtcttcatcagcatcggctctgccctgggcttcaaatacccgctgggg
aacaaccagaccgcagtccaggacaacgtgaaggtgtcgctggccttcggactgagcatc
gccacgctggcacagagcgtgggtcacatcagtggcgcccacctcaacccggctgtcacg
ctggggctgctgctcagctgccagatcagcatcttccgtgccctcatgtacatcatcgcc
cagtgcgtgggggccatcgtcgccaccgccatcctctcaggcatcacctcctccctgccc
gggaactccctcggccgcaatgacctggctgatggcgtgaactcgggccagggcctgggc
atcgagatcatcgggaccctccagctggtgctgtgtgtgctggccactaccgaccggagg
cgccgcgaccttggtggctcagccccgcttgccatcggcctctctgtagccctcggacac
ctcctggctattgactacaccggctgtgggattaaccctgctcggtccttcggctccgca
gtgatcacacacaacttcagcaaccactggattttctgggtggggccattcatcggggca
gccctggctgtactcatctacgacttcatcctggccccacgcagcagtgacttcacagac
cgcgtgaaggtgtggaccagcggccaggtggaggagtatgacctggatgctgacgacatc
aactccagggtggagatgaagcccaaatag

DBGET integrated database retrieval system