KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663741
Entry
104663741         CDS       T03989                                 

Gene name
ADCYAP1R1
Definition
(RefSeq) pituitary adenylate cyclase-activating polypeptide type I receptor isoform X1
  KO
K04587  pituitary adenylate cyclase-activating polypeptide type I receptor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04024  cAMP signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04713  Circadian entrainment
rro04911  Insulin secretion
rro04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    104663741 (ADCYAP1R1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104663741 (ADCYAP1R1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    104663741 (ADCYAP1R1)
   04924 Renin secretion
    104663741 (ADCYAP1R1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104663741 (ADCYAP1R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104663741 (ADCYAP1R1)
G protein-coupled receptors [BR:rro04030]
 Secretin receptor family
  Gut peptide
   Vasoactive intestinal polypeptide (VIP) and pituitary adenyl cyclase-activating peptide (PACAP)
    104663741 (ADCYAP1R1)
SSDB
Motif
Pfam: 7tm_2 HRM Insulin_TMD Dicty_CAR
Other DBs
NCBI-GeneID: 104663741
NCBI-ProteinID: XP_010363371
UniProt: A0A2K6QPB9
LinkDB
Position
6
AA seq 496 aa
MACVVQVSLAALLLLPMAPAMHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDN
ITCWKPAHVGEMVLVSCPELFRIFNPDRVWETETIGESDFGDSNSLDLSDMGVVSRNCTE
DGWSEPFPHYFDACGFDEYESETGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRK
LHCTRNFIHMNLFVSFMLRAISVFIKDWILYAEQDSNHCFISTVECKAIMVFFHYCVVSN
YFWLFIEGLYLFTLLVETFFPERRYFYWYTIIGWGTPTVCVTVWATLRLYFDDTGCWDMN
DSTALWWVIKGPVVGSIMVNFVLFIGIIVILVQKLQSPDMGGNESSIYFSCVQKCYCKPQ
RAQQHSCKMSELSTITLRLARSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQ
GFVVAVLYCFLNGEVQAEIKRKWRSWKVNRYFAVDFKHRHPSLASSGVNGGTQLSILSKS
SSQIRMSGLPADNLAT
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggcttgtgtcgtgcaggtttccctggctgctctcctcctgctgcctatggcccctgcc
atgcattctgactgcatcttcaagaaggagcaagccatgtgcctggagaagatccagagg
gccaatgagctgatgggcttcaatgattcctctccaggctgtcctgggatgtgggacaac
atcacgtgttggaagcctgcccacgtgggtgagatggtcctggtcagctgccctgaactc
ttccgaatcttcaacccagaccgagtctgggagaccgaaaccattggagagtctgatttt
ggtgacagtaactccttagatctctcagacatgggagtggtgagccggaactgcacggag
gatggctggtcggagcccttccctcattactttgatgcctgtgggtttgatgaatatgaa
tctgagactggggaccaggattattactacctgtcagtgaaggccctctacacggttggc
tacagcacttccctcgtcaccctcaccactgccatggtcatcctgtgtcgcttccggaag
ctgcactgcacacgcaacttcatccacatgaacctgtttgtgtcgttcatgctgagggcg
atctccgtcttcatcaaagactggattctgtatgcggagcaggacagcaatcactgcttc
atctccaccgtggagtgtaaggccatcatggttttcttccactactgtgttgtgtccaac
tacttctggctgttcatcgagggcctgtacctcttcactctgctggtggagaccttcttc
cctgaaaggagatacttctactggtacaccattattggctgggggaccccaactgtgtgc
gtgacggtgtgggctacgctaagactctactttgatgacacaggctgctgggatatgaat
gacagcacagctctgtggtgggtgatcaaaggccctgtggttggctctatcatggttaac
tttgtgctttttattggcattatcgtcatccttgtgcagaaacttcagtctccagacatg
ggaggcaatgagtccagcatctacttcagctgcgtgcagaaatgctactgcaagccacag
cgggctcagcagcactcttgcaagatgtcagaactgtccaccattactctgcggctggcc
cggtccaccctgctgctcatcccactattcggaatccactacacagtattcgccttctcc
ccagagaacgtcagcaaaagggaaagactcgtgtttgagctggggctgggctccttccag
ggctttgtggtggctgttctctactgttttctgaatggcgaggtacaagcggagatcaag
cgaaaatggcgaagctggaaggtgaaccgttactttgctgtggacttcaagcaccgacac
ccatctctggccagcagtggggtgaacgggggcacccagctctccatcctgagcaagagc
agctcccaaatccgcatgtctggcctccctgctgacaatctggccacctga

DBGET integrated database retrieval system