KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663797
Entry
104663797         CDS       T03989                                 

Gene name
GNAS
Definition
(RefSeq) guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas isoform X1
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04024  cAMP signaling pathway
rro04072  Phospholipase D signaling pathway
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04540  Gap junction
rro04611  Platelet activation
rro04713  Circadian entrainment
rro04714  Thermogenesis
rro04724  Glutamatergic synapse
rro04726  Serotonergic synapse
rro04728  Dopaminergic synapse
rro04730  Long-term depression
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04913  Ovarian steroidogenesis
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04924  Renin secretion
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04961  Endocrine and other factor-regulated calcium reabsorption
rro04962  Vasopressin-regulated water reabsorption
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04972  Pancreatic secretion
rro04976  Bile secretion
rro05012  Parkinson disease
rro05030  Cocaine addiction
rro05031  Amphetamine addiction
rro05032  Morphine addiction
rro05034  Alcoholism
rro05142  Chagas disease
rro05146  Amoebiasis
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104663797 (GNAS)
   04020 Calcium signaling pathway
    104663797 (GNAS)
   04072 Phospholipase D signaling pathway
    104663797 (GNAS)
   04024 cAMP signaling pathway
    104663797 (GNAS)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104663797 (GNAS)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104663797 (GNAS)
  09152 Endocrine system
   04911 Insulin secretion
    104663797 (GNAS)
   04922 Glucagon signaling pathway
    104663797 (GNAS)
   04923 Regulation of lipolysis in adipocytes
    104663797 (GNAS)
   04912 GnRH signaling pathway
    104663797 (GNAS)
   04913 Ovarian steroidogenesis
    104663797 (GNAS)
   04915 Estrogen signaling pathway
    104663797 (GNAS)
   04921 Oxytocin signaling pathway
    104663797 (GNAS)
   04926 Relaxin signaling pathway
    104663797 (GNAS)
   04935 Growth hormone synthesis, secretion and action
    104663797 (GNAS)
   04918 Thyroid hormone synthesis
    104663797 (GNAS)
   04928 Parathyroid hormone synthesis, secretion and action
    104663797 (GNAS)
   04916 Melanogenesis
    104663797 (GNAS)
   04924 Renin secretion
    104663797 (GNAS)
   04925 Aldosterone synthesis and secretion
    104663797 (GNAS)
   04927 Cortisol synthesis and secretion
    104663797 (GNAS)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104663797 (GNAS)
   04270 Vascular smooth muscle contraction
    104663797 (GNAS)
  09154 Digestive system
   04970 Salivary secretion
    104663797 (GNAS)
   04971 Gastric acid secretion
    104663797 (GNAS)
   04972 Pancreatic secretion
    104663797 (GNAS)
   04976 Bile secretion
    104663797 (GNAS)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    104663797 (GNAS)
   04961 Endocrine and other factor-regulated calcium reabsorption
    104663797 (GNAS)
  09156 Nervous system
   04724 Glutamatergic synapse
    104663797 (GNAS)
   04728 Dopaminergic synapse
    104663797 (GNAS)
   04726 Serotonergic synapse
    104663797 (GNAS)
   04730 Long-term depression
    104663797 (GNAS)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104663797 (GNAS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104663797 (GNAS)
   04714 Thermogenesis
    104663797 (GNAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104663797 (GNAS)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    104663797 (GNAS)
  09165 Substance dependence
   05030 Cocaine addiction
    104663797 (GNAS)
   05031 Amphetamine addiction
    104663797 (GNAS)
   05032 Morphine addiction
    104663797 (GNAS)
   05034 Alcoholism
    104663797 (GNAS)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    104663797 (GNAS)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104663797 (GNAS)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104663797 (GNAS)
   05165 Human papillomavirus infection
    104663797 (GNAS)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104663797 (GNAS)
   05142 Chagas disease
    104663797 (GNAS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104663797 (GNAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104663797 (GNAS)
   04031 GTP-binding proteins [BR:rro04031]
    104663797 (GNAS)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104663797 (GNAS)
  Exosomal proteins of other body fluids (saliva and urine)
   104663797 (GNAS)
  Exosomal proteins of colorectal cancer cells
   104663797 (GNAS)
  Exosomal proteins of bladder cancer cells
   104663797 (GNAS)
GTP-binding proteins [BR:rro04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    104663797 (GNAS)
SSDB
Motif
Pfam: G-alpha Arf Roc Gtr1_RagA
Other DBs
NCBI-GeneID: 104663797
NCBI-ProteinID: XP_030770178
LinkDB
Position
13
AA seq 1041 aa
MGMRNCLDGNNMSGQRDIPPEIGEQPDQPSLEAPGAAAPGAGPSPAEEMETEPPHNEPIP
IKNDSEACGPPEVSRPNFQVLNLAFREAGANGSYSPPPEEAMPFEVEQSSLGGFWPTLEQ
PGSPSGAHAGLEASGPAFMEPGAFSGARPGLGGYSPPPEEAMPFEFDQPAKRGCSQPLLQ
VPDLAPGGPGAAGVPGAPPEEPQALRPAKTGSRGGYSPPPEETMPFELDGEGFGDDSPPP
GLSRVIAQVDGGGQFAAVAASSAVRLTPAANAPPLWVPGAIGSPSREAVRPPPNFTGSSP
PMEISGPPLEMGSAPAGVDDAPVNMDSPPIALDGPPIKVSGAPDKRERAERPPVEEEAAE
MEGSTAADAAEGGKVPSPGYGSPAAGAASADTATGAARAAPADPDSRAAPEDPDSGAAPE
DPDSGAAPAAPADPDSGAAPDAPADPDSGAAPDAPADPDSGAAPDAPADPDAGAAPDVPA
APAAAETRAAHVAPAAPDAGAPTAPAASATRAAQAARAASAAPASGARRKLHLLRPPSPE
IQAADPPTPRPTRASAWRGKSERSRRGYYDEGAASSDDDSSGDESDDGTFGCIRWFQHRR
NRRRRKPRRNLLRNFLMQAFGGCFGRSESPQPKVSRSPKVKKVPLAEKRRQMRKEALEKR
AQKRAEKKRSKLIDKQLQDEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGG
EEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILS
VMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPS
DQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSY
NMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFP
EFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIR
RVFNDCRDIIQRMHLRQYELL
NT seq 3126 nt   +upstreamnt  +downstreamnt
atgggcatgcgcaactgcctcgacggcaataatatgtcaggacaacgcgatatcccccct
gaaatcggggaacaacccgatcaaccatctttggaggccccaggggcagctgcccccggt
gctgggcctagcccagccgaagagatggagaccgaaccgcctcacaacgagcccatcccc
atcaagaatgacagcgaggcctgtggacccccagaggtctccaggcccaactttcaggtc
ctcaacctggcattcagggaagctggagccaatggaagctacagcccacctcctgaggaa
gcaatgcccttcgaggtggaacagtccagcttgggaggcttctggcctacactggagcag
cctggatcccccagtggggcccatgcaggccttgaggcctccggcccagcattcatggaa
cctggagccttcagtggtgccagaccaggcctgggaggatacagccctccaccagaagaa
gctatgccctttgagtttgaccagcctgccaagagaggctgcagtcaacctctcttacag
gtcccagaccttgctccaggaggcccaggtgctgcaggggtccccggagctcctcccgag
gagccccaagccctcaggcctgcaaagactggctccagaggaggctacagccctccccct
gaggagactatgccatttgagcttgacggagaaggatttggggacgacagcccacccccg
gggctttcccgagttatcgcacaagttgacggcggcggccagttcgcggcagtcgcggcc
tcgagtgcggtccgcctcactcccgccgcgaacgcgcctcccctctgggtcccaggcgcc
atcggcagcccatcccgagaggctgtcagacctcctcctaacttcacgggcagtagcccc
ccgatggagatctccggacccccactcgagatgggcagcgcccccgctggggtcgacgac
gctcccgtcaacatggacagccccccaatcgcgcttgacggcccgcccatcaaggtctcc
ggagccccagataagagagagcgagcagagagacccccagttgaggaggaagcagcagag
atggaaggaagcacagccgctgatgccgcggagggaggaaaagtcccctctccggggtac
ggatcccctgccgccggggcagcctcagcggataccgccaccggggcagcccgtgcagcc
ccagcagatcccgactccagggcagccccagaagatcccgactctggggcagccccagaa
gatcccgactccggggcagcccctgccgccccggccgatcccgactccggggcggcccct
gacgccccggccgatcccgactccggggcggcccctgacgccccggcggatcccgactcc
ggggctgcccctgacgccccggccgatccagacgccggggcagcccctgacgttcccgcc
gcccctgcggctgctgagacccgggcagcccatgtcgccccagctgcgcctgacgccggg
gctcccactgccccagccgcttctgccacccgggcagcccaagccgcccgggcggcctct
gcagcccctgcctccggggccagacgcaagctccatctccttagaccccccagccccgag
atccaggctgccgatccgcctactccgcggcctactcgcgcgtctgcttggcggggcaag
tccgagcgcagccgccgcggttactacgatgaaggggcggccagcagcgacgatgactcc
agcggagacgagtccgacgatgggaccttcggatgcatccgctggtttcagcatcggcga
aatcgccgccgccgaaagcccaggcgcaacttactccgcaactttctcatgcaagccttc
gggggctgcttcggtcgatctgagagtccccagcccaaagtctcgcgctcccccaaggtc
aagaaggtacccctggcagagaagcgcagacagatgcgcaaagaagccctggagaagcgg
gcccagaagcgcgcagagaagaaacgcagcaagctcatcgacaaacaactccaggacgaa
aagatgggctacatgtgtacgcaccgcctgctgcttctaggtgctggagaatctggtaaa
agcaccattgtgaagcagatgaggatcctgcatgttaatgggtttaatggagagggcggc
gaagaggacccgcaggctgcaaggagcaacagcgatggtgagaaggcaaccaaagtgcag
gacatcaaaaacaacctgaaagaggcgatcgaaaccatcgtggccgccatgagcaacctg
gtgccccccgtggagctggccaaccccgagaaccagttcagagtggactacattctgagt
gtgatgaacgtgcctgactttgacttccctcccgaattctacgagcatgccaaggctctg
tgggaggatgaaggagtgcgtgcctgctatgaacgctccaacgagtaccagctgattgac
tgcgcccagtacttcctggacaagatcgatgtgatcaagcaggctgactatgtgccgagc
gaccaggacctgcttcgctgccgcgtcctgacttctggaatcttcgagaccaagttccag
gtggacaaagtcaacttccacatgtttgacgtgggtggccagcgtgatgaacgccgcaag
tggatccagtgcttcaacgatgtgactgccatcatcttcgtggtggccagcagcagctac
aacatggtcatccgggaggacaaccagaccaaccgcctgcaggaggctctgaacctcttc
aagagcatctggaacaacagatggctgcgcaccatctctgtgattctgttcctcaacaag
caagatctgctcgctgagaaagtccttgctgggaaatcgaagattgaggactactttcca
gaatttgctcgctacactactcctgaggatgccactcccgagcccggagaggacccacgt
gtgacccgggccaagtacttcattcgagatgagtttctgaggatcagcactgccagtgga
gatgggcgtcactactgctaccctcacttcacctgcgctgtggacactgagaacatccgc
cgtgtgttcaacgactgccgtgacatcattcagcgcatgcaccttcgtcagtacgagctg
ctctaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663799
Entry
104663799         CDS       T03989                                 

Definition
(RefSeq) neuroendocrine secretory protein 55
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04024  cAMP signaling pathway
rro04072  Phospholipase D signaling pathway
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04540  Gap junction
rro04611  Platelet activation
rro04713  Circadian entrainment
rro04714  Thermogenesis
rro04724  Glutamatergic synapse
rro04726  Serotonergic synapse
rro04728  Dopaminergic synapse
rro04730  Long-term depression
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04913  Ovarian steroidogenesis
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04924  Renin secretion
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04961  Endocrine and other factor-regulated calcium reabsorption
rro04962  Vasopressin-regulated water reabsorption
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04972  Pancreatic secretion
rro04976  Bile secretion
rro05012  Parkinson disease
rro05030  Cocaine addiction
rro05031  Amphetamine addiction
rro05032  Morphine addiction
rro05034  Alcoholism
rro05142  Chagas disease
rro05146  Amoebiasis
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104663799
   04020 Calcium signaling pathway
    104663799
   04072 Phospholipase D signaling pathway
    104663799
   04024 cAMP signaling pathway
    104663799
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104663799
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104663799
  09152 Endocrine system
   04911 Insulin secretion
    104663799
   04922 Glucagon signaling pathway
    104663799
   04923 Regulation of lipolysis in adipocytes
    104663799
   04912 GnRH signaling pathway
    104663799
   04913 Ovarian steroidogenesis
    104663799
   04915 Estrogen signaling pathway
    104663799
   04921 Oxytocin signaling pathway
    104663799
   04926 Relaxin signaling pathway
    104663799
   04935 Growth hormone synthesis, secretion and action
    104663799
   04918 Thyroid hormone synthesis
    104663799
   04928 Parathyroid hormone synthesis, secretion and action
    104663799
   04916 Melanogenesis
    104663799
   04924 Renin secretion
    104663799
   04925 Aldosterone synthesis and secretion
    104663799
   04927 Cortisol synthesis and secretion
    104663799
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104663799
   04270 Vascular smooth muscle contraction
    104663799
  09154 Digestive system
   04970 Salivary secretion
    104663799
   04971 Gastric acid secretion
    104663799
   04972 Pancreatic secretion
    104663799
   04976 Bile secretion
    104663799
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    104663799
   04961 Endocrine and other factor-regulated calcium reabsorption
    104663799
  09156 Nervous system
   04724 Glutamatergic synapse
    104663799
   04728 Dopaminergic synapse
    104663799
   04726 Serotonergic synapse
    104663799
   04730 Long-term depression
    104663799
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104663799
  09159 Environmental adaptation
   04713 Circadian entrainment
    104663799
   04714 Thermogenesis
    104663799
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104663799
  09164 Neurodegenerative disease
   05012 Parkinson disease
    104663799
  09165 Substance dependence
   05030 Cocaine addiction
    104663799
   05031 Amphetamine addiction
    104663799
   05032 Morphine addiction
    104663799
   05034 Alcoholism
    104663799
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    104663799
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104663799
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104663799
   05165 Human papillomavirus infection
    104663799
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104663799
   05142 Chagas disease
    104663799
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104663799
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104663799
   04031 GTP-binding proteins [BR:rro04031]
    104663799
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104663799
  Exosomal proteins of other body fluids (saliva and urine)
   104663799
  Exosomal proteins of colorectal cancer cells
   104663799
  Exosomal proteins of bladder cancer cells
   104663799
GTP-binding proteins [BR:rro04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    104663799
SSDB
Motif
Pfam: NESP55
Other DBs
NCBI-GeneID: 104663799
NCBI-ProteinID: XP_030770189
LinkDB
Position
13
AA seq 251 aa
MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARATSNARAQQ
RRSFLNAHHRSSAQVFPEPPESESDHEHEEADLELSLPECLEYEEEFDYETESETESEIE
SETDFETEPETAPTTEPETEPEDERGPVVPKHSTFGQSLTDSQSLTQRLHALKLRSPDAS
PSRAPPSTQEPQSPREGEELKPEDKDPRDPEESEEPKEKKQRRRCKPKKPTRRDASPESP
SKKGPIPIRRH
NT seq 756 nt   +upstreamnt  +downstreamnt
atggatcggaggtcccgggctcagcagtggcgccgagctcgccataattacaacgacctg
tgcccgcccataggccgccgcgcagccaccgcgctcctctggctctcctgctccatcgcg
ctcctccgcgcccttgccacctccaacgcccgtgccacctccaacgcccgtgcccagcag
cgccggagcttcctgaacgcccaccaccgctccagcgctcaggtattccctgagcccccc
gaatcggaatctgaccacgagcacgaggaggcagaccttgagctgtcccttcccgagtgc
ctagagtacgaggaagagttcgactacgagaccgagagcgagaccgagtccgaaatcgag
tccgagaccgacttcgagaccgagcctgagaccgcccccaccactgagcccgagaccgag
ccagaagacgagcgcggccctgtggtgcccaagcactccaccttcggccagtccctcacc
gacagccagtctctcacccagcgtctgcacgctctcaagttgcgaagccccgacgcctcc
ccaagtcgcgcgccacccagcactcaggagccccagagccccagggagggggaggagctc
aagcccgaagacaaagatccaagggaccccgaagagtctgaggagcccaaggagaagaag
cagcggcgtcgctgcaagcctaagaagcccacccgccgtgacgcgtccccggagtcccct
tccaaaaagggacccatccccatccggcgtcactaa

DBGET integrated database retrieval system