KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663908
Entry
104663908         CDS       T03989                                 

Gene name
SCN9A
Definition
(RefSeq) sodium channel protein type 9 subunit alpha isoform X1
  KO
K04841  voltage-gated sodium channel type IX alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104663908 (SCN9A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104663908 (SCN9A)
Ion channels [BR:rro04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   104663908 (SCN9A)
SSDB
Motif
Pfam: Ion_trans Na_trans_cytopl Na_trans_assoc PKD_channel GPHH IQ
Other DBs
NCBI-GeneID: 104663908
NCBI-ProteinID: XP_010363600
LinkDB
Position
14
AA seq 1988 aa
MATLPPPGPQSFVHFTKQSLALIEQRIAEGKSKEPKEEKKDDDEEAPKPSSDLEAGKQLP
FIYGDIPPGMVSEPLEDLDPYYADKKTFIVLNKGKTIFRFNATPALYMLSPFSPLRRLSI
KILVHSLFSMLIMCTILTNCIFMTLSNPPDWTKNVEYTFTGIYTFESLVKILARGFCVGE
FTFLRDPWNWLDFVVIVFAYLTEFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQ
SVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCVQNTLENNETLESIMNTLESEEDFR
KYFYYLEGSKDALLCGFSTDSGQCPEGYTCMKIGRNPDYGYTSFDTFSWAFLALFRLMTQ
DYWENLYQQTLRAAGKTYMIFFVVVIFLGSFYLINLILAVVAMAYEEQNQANIEEAKQKE
LEFQQMLDRLKKEQEEAEAIAAAAAEYTSIRRSRIMGLSESSSETSKLSSKSAKERRNRR
KKKNQKKLSSGEEKGDAEKLSKSDSEENIRRKSFHLGVEGHRRAHEKRLSTPNQSPLSIR
GSLFSARRSSRTSLFSFKGRGRDIGSETDFADDEHSIFGDNESRRGSLFVPRRPQERRSS
NISQASRSPPMLPVNGKMHSAVDCNGVVSLVDGRSALMLPNGQLLPEVIIDKATSDDSGT
TNQIHKKRRCSSYLLSEDMLNDPNLRQRAMSRASILTNTVEELEESRQKCPPWWYRFAHK
FLIWNCSPYWIKFKKCIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTEEFKNVLAIGN
LVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLADVEGLSVLRSFRLL
RVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKIN
DDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVYMMVMVIGNLVVL
NLFLALLLSSFSSDNLTAIEEDPDANNLQIAVTRIKKGINYVKQTLREFILKAFSKKPKI
SREIRQTEDLNTKKENYISNYTLAEMSKGHNFLKEKDKISGFGSSVDKYLMEDSDGQSFI
HNPSLTVTVPIAPGESDLENMNAEELSSDSDSEYSKVRLNQSSSSECSTVDNPLPGEGEE
AEAEPMNSDEPEACFTDGCVRRFSCCQVNIESGKGKIWWNIRKTCYKIVEHSWFESFIVL
MILLSSGALAFEDIYIERKKTIKIILEYADKIFTYIFILEMLLKWIAYGYKTYFTNAWCW
LDFLIVDVSLVTLVANTLGYSDLGPVKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPS
IMNVLLVCLIFWLIFSIMGVNLFAGKFYECINTTDGSRFPASQVPNRSECFALMNVSQNV
RWKNLKVNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFVIF
IIFGSFFTLNLFIGVIIDNFNQQKKKLGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRP
GNKIQGCIFDLVTNQAFDISIMVLICLNMVTMMVEKEGQSPYMTDVLYWINVVFIILFTG
ECVLKLISLRYYYFTVGWNIFDFVVVIISIVGMFLADLIETYFVSPTLFRVIRLARIGRI
LRLVKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEDGINDMFN
FETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPKKVHPGSSVEGDCGNPSVGIFYF
VSYIIISFLVVVNMYIAVILENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEYS
KLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDSLR
SQMEERFMSANPSKVSYEPITTTLKRKQEDVSATVIQRAYRRYRLRQNVKNISSIYIKDG
DRDDDLLNKKDMVFDNANENSSPEKTDATSSTTSPPSYDSVTKPDKEKYEQDRTEKEDKG
KDSKESKK
NT seq 5967 nt   +upstreamnt  +downstreamnt
atggcaacgttgcctcccccaggacctcagagctttgtccacttcacaaaacagtctctt
gccctcattgaacaacgcattgctgaaggaaaatcaaaggaacccaaagaagaaaagaaa
gacgacgatgaagaagccccaaagccaagcagcgacttggaagctggcaaacagctgccc
ttcatctatggggacattcctcccggcatggtgtcagagcccctggaggacctggacccc
tactatgcagacaaaaaaactttcatagtattgaacaaagggaaaacaatcttccgtttc
aatgccacacctgctttatatatgctttctcctttcagtcctctaagaagactatctatt
aagattttagtacactccttattcagcatgctcatcatgtgcactattctgacaaactgc
atatttatgaccttgagtaacccaccggactggaccaaaaatgtcgagtacacttttact
ggaatatatacttttgaatcacttgtaaaaatccttgcaagaggcttctgtgtaggagaa
ttcacttttcttcgtgacccgtggaactggctggattttgtcgtcattgtttttgcgtat
ttaacagaatttgtaaacctaggcaatgtttcagctcttcgaactttcagagtattgaga
gctttgaaaactatttctgtaatcccaggcctgaagacaattgtgggggctttgatccag
tcagtgaagaagctttctgacgtcatgatcctgactgtgttctgtctgagtgtgtttgca
ctaattggactacagctgttcatgggaaacctgaagcataaatgtgttcagaatacactt
gaaaataatgaaacattagaaagcataatgaataccctagagagtgaagaagactttaga
aaatatttttattacttggagggatccaaagatgctctcctttgtggtttcagcacagat
tcaggccaatgtccagaggggtacacctgtatgaaaattggcagaaaccctgattatggc
tacacgagctttgacactttcagctgggccttcttagccttgtttaggctaatgacccaa
gattactgggaaaacctttaccaacagacgctgcgtgctgctggcaaaacctacatgatc
ttctttgtcgtagtgattttcctgggctccttttatctaataaacttgatcttggctgtg
gttgccatggcttatgaagaacagaaccaggcaaacattgaagaagctaaacagaaagaa
ttagaatttcaacagatgttagaccgacttaaaaaagagcaagaagaagctgaggcaatc
gcagcggcagcagctgaatatacaagtattaggagaagcagaattatgggcctctcagag
agttcttctgaaacatccaaactgagctctaaaagtgctaaagaaagaagaaacagaaga
aagaaaaagaatcaaaagaagctctccagtggagaagaaaagggagatgctgagaaattg
tccaaatcagattcagaggagaacatcagaagaaaaagtttccaccttggtgtcgaaggg
cataggcgagcacatgaaaagagattgtctacccccaatcagtcaccactcagcattcgt
ggctccttgttttctgcaaggcgaagcagcagaacaagtctttttagtttcaaaggccga
ggaagagatataggatctgagactgactttgccgatgacgagcacagcatttttggagac
aatgagagcagaaggggctcactgtttgtgccccgcagaccccaggagcgacgcagcagt
aacatcagccaagccagtaggtccccaccaatgctgccggtgaacgggaaaatgcacagt
gctgtggactgcaacggtgtggtctccctggttgatggacgctcagccctcatgctcccc
aatggacagcttctgccagaggtgataatagataaggcaacttctgatgacagcggcaca
accaatcaaatacacaagaaaaggcgttgtagttcctatctcctttcagaggatatgctg
aatgatcctaacctcagacagagagcaatgagtagagcaagcatattaacaaacactgtg
gaagaacttgaagagtccagacaaaaatgtccaccttggtggtacagatttgcacacaaa
ttcttgatctggaattgctctccatattggataaaattcaaaaagtgtatctattttatt
gtaatggatccttttgtagatcttgcaattaccatttgcatagttttaaacacattattt
atggctatggaacatcacccaatgactgaggaattcaaaaatgtacttgctataggaaat
ttggtctttactggaatctttgcagctgaaatggtattaaaactgattgccatggatcca
tatgagtatttccaagtaggctggaatatttttgacagccttattgtgactttaagttta
gtggagctctttctagcagatgtggaaggactgtcagttctgcgatcattcagactgctc
cgagtcttcaagttggcaaaatcctggccaacattgaacatgctgattaagatcattggt
aactcggtaggggctctaggtaaccttaccttagtgttggccatcatcgtcttcattttt
gctgtggtcggcatgcagctctttggtaagagctacaaagaatgtgtctgcaagatcaat
gatgactgtacactcccacggtggcacatgaacgacttcttccactccttcctgattgtg
ttccgcgtgctgtgtggagagtggatagagaccatgtgggactgtatggaggttgctggt
caagctatgtgccttattgtttacatgatggtcatggtcattggaaacctggtggtccta
aacctatttctggccttattattgagttcatttagttcagacaatcttacagcaattgaa
gaagaccctgatgcaaacaacctccagattgcagtgaccagaattaaaaagggaataaat
tatgtgaagcaaaccttacgtgaatttattctaaaagcattttccaaaaaaccaaagatt
tccagggagataagacaaacagaagatctgaatactaagaaggaaaactatatttctaac
tatacacttgctgaaatgagcaaaggtcacaatttcctcaaggaaaaagataaaatcagt
ggttttggaagcagcgtggacaaatacttgatggaagacagtgatggtcaatcatttatt
cacaatcccagcctcacagtgacagtgccaattgcccctggggaatccgatttggaaaat
atgaatgctgaggaacttagcagtgattcagatagtgaatacagcaaagtgagattaaac
caatcaagctcctcagagtgcagcacagtcgataaccctttgcctggagaaggagaagaa
gcagaggctgaacctatgaattccgatgagccagaagcctgtttcacagatggttgtgtc
cggaggttctcatgctgccaagttaacatagagtcagggaaaggaaaaatctggtggaac
atcaggaaaacctgctacaagattgttgaacacagttggtttgaaagcttcattgtcctc
atgatcctgctcagcagtggtgccctggcttttgaagatatatatattgaaaggaaaaag
accattaagattatcctggagtatgcagacaagatcttcacttacatcttcattctggaa
atgcttctaaagtggatagcatatggttataaaacatacttcaccaatgcctggtgttgg
ctggatttcctaattgttgatgtttctttggttactttagtggcaaacactcttggctac
tcagatcttggccccgttaaatctcttcggacgctgagagctttaagacctctaagagcc
ttatctagatttgaaggaatgagggtggttgtgaatgcacttataggagcaattccttcc
atcatgaatgtgctacttgtgtgtcttatattctggctgatattcagcatcatgggagta
aatttgtttgctggcaagttctatgagtgtattaacaccacagatgggtcacggtttcct
gcaagtcaagttccaaatcgttctgaatgttttgcccttatgaatgttagtcaaaatgtg
cgatggaaaaacctgaaagtgaactttgataatgtcggacttggttacctatctctgctt
caagttgcaacatttaagggatggaccattattatgtatgcagcagtggattccgttaat
gtagacaagcagcccaaatatgaatatagcctctacatgtatatttattttgtcatcttt
atcatctttgggtcattcttcactttgaacttgttcattggtgtcatcatagataatttc
aaccaacagaaaaagaagcttggaggtcaagacatctttatgacagaagaacagaagaaa
tactataatgcaatgaaaaagctgggatccaagaagccacaaaagccaattcctcgacca
gggaacaaaatccaaggatgtatatttgacctagtgacaaatcaagcatttgatatcagt
atcatggttcttatctgtctcaacatggtaaccatgatggtagaaaaggagggtcaaagt
ccatatatgactgacgttttatattggataaatgtggtttttataatccttttcactgga
gaatgtgtgctaaaactgatctccctcagatactactacttcactgtaggatggaatatt
tttgattttgtggttgtgattatctccattgtaggtatgtttctagctgatttgattgaa
acatattttgtgtcccctaccctgttccgagtgatccgtcttgccaggattggccgaatc
ttacgtctagtcaaaggagcaaaggggatccgcacgctgctctttgctttgatgatgtcc
ctccctgcattgtttaacatcggcctcctgctcttcctggtcatgttcatctacgccatc
tttgggatgtccaactttgcctatgttaaaaaggaagatggaattaatgacatgttcaat
tttgagacctttggcaacagtatgatttgcctgttccaaattacaacctctgctggctgg
gatggattgctagcgcctattcttaacagtaagccacctgactgtgatccaaaaaaagtt
catcctggaagttcagttgaaggagactgtggtaacccatctgttggaatattctacttt
gtcagttacatcatcatttccttcctggttgtggtgaacatgtacattgcagtcatactg
gagaattttagtgttgccactgaagaaagtactgaacctctgagtgaggatgactttgag
atgttctatgaagtttgggagaagtttgatccagatgcaactcagtttatagaatatagc
aagctctctgattttgcagctgccctggatcctcctcttctcatagcaaaacccaacaaa
gtccagctcattgccatggatctgcccatggtcagtggtgaccggatccattgtcttgac
atcttatttgcttttacaaagcgtgttttgggtgagagtggggagatggattctcttcgt
tcacagatggaagaaaggttcatgtctgcaaatccttccaaagtttcctatgaacccatc
acaaccacactgaaacggaaacaagaggatgtgtctgctactgtcattcaacgtgcttat
agacgttaccgcttaaggcaaaatgtcaaaaatatatcaagtatatacataaaagatgga
gacagagatgatgatttactcaataaaaaagatatggtttttgataacgctaatgagaac
tcaagtccagaaaaaacagatgccacttcatccaccacctctccaccttcatatgatagt
gtaacaaagccagacaaagagaaatatgaacaagacagaacagaaaaggaagacaaaggg
aaagacagcaaggaaagcaaaaaatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663916
Entry
104663916         CDS       T03989                                 

Gene name
SCN2A
Definition
(RefSeq) sodium channel protein type 2 subunit alpha isoform X1
  KO
K04834  voltage-gated sodium channel type II alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104663916 (SCN2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104663916 (SCN2A)
Ion channels [BR:rro04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   104663916 (SCN2A)
SSDB
Motif
Pfam: Ion_trans Na_trans_cytopl Na_trans_assoc PKD_channel GPHH ATP-synt_B IQ
Other DBs
NCBI-GeneID: 104663916
NCBI-ProteinID: XP_010363608
UniProt: A0A2K6R0F9
LinkDB
Position
14
AA seq 2005 aa
MAQSVLVPPGPDSFRFFTRESLAAIEQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGK
SLPFIYGDIPPEMVSVPLEDLDPYYINKKTFIVLNKGKAISRFSATPALYILTPFNPIRK
LAIKILVHSLFNMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFC
LEDFTFLRDPWNWLDFTVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGA
LIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSSFEINITSFFNNSL
DGNGTTFNRTVSMFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNP
NYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLI
LAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAAAAAASAESRDFSGAGGI
GVFSESSSVASKLSSKSEKELKNRRKKKKQKEQSGEEEKNDRVRKSESEDSIRRKGFRFS
LEGSRLTYEKRFSSPHQSLLSIRGSLFSPRRNSRASLFSFRGRAKDIGSENDFADDEHST
FEDNDSRRDSLFVPHRHGERRHSNVSQASRASRVLPILPMNGKMHSAVDCNGVVSLVGGP
STLTSAGQLLPEGTTTETEIRKRRSSSYHVSMDLLEDPTSRQRAMSIASILTNTMEELEE
SRQKCPPCWYKFANMCLIWDCCKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEH
YPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGL
ANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGM
QLFGKSYKECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCL
TVFMMVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDFVKRK
IREFIQKAFVRKQKALDEIKPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIGS
SVEKYVVDESDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESDMEESKEKLNATSS
SEGSTVDIGAPAEGEQPEVEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKT
CYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLK
WVAYGFQVYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRF
EGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVV
NNYSECKALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQ
PKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNA
MKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMT
NILYWINLVFIVLFTGECVLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFV
SPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMS
NFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPEKDHPGS
SVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYE
VWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFA
FTKRVLGESGEMDALRIQMEERFMASNPSKISYEPITTTLKRKQEEVSAIIIQRAYRRYL
LKQKVKKVSSIYKKDKGKECDGTPIKEDTLIDKLNENSTPEKTDMTPSTTSPPSYDSVTK
PEKEKFEKDKSEKEDKGKDIRESKK
NT seq 6018 nt   +upstreamnt  +downstreamnt
atggcacagtcagtgctggtaccgccaggacctgacagcttccgcttctttaccagggaa
tcccttgctgctattgaacaacgcattgcagaagagaaagctaagagacccaaacaggaa
cgcaaggatgaggatgatgaaaatggcccaaagccaaacagtgacttggaagcaggaaaa
tctcttccatttatttatggagacattcctccagagatggtgtcagtgcccctggaggat
ctggacccctactatatcaataagaaaacgtttatagtattgaataaagggaaagcaatc
tctcgattcagtgccacccccgccctttacattttaactcccttcaaccctattagaaaa
ttagctattaagattttggtacattctttattcaatatgctcattatgtgcactattctt
accaactgtgtatttatgaccatgagtaaccctccagactggacaaagaatgtggagtat
acctttacaggaatttatacttttgaatcacttattaaaatacttgcaaggggcttttgt
ttagaagatttcacatttttacgggatccatggaattggttggatttcacagtcattact
tttgcatatgtgacagagtttgtggacctgggcaatgtctcagcgttgagaacattcaga
gttctccgagcattgaaaacaatttcagtcattccaggcctgaagaccattgtgggggcc
ctgatccagtcagtgaagaagctttctgatgtcatgatcttgactgtgttctgtctaagc
gtgtttgcgctaataggattacagttgttcatgggcaacctacgaaataaatgtttgcaa
tggcctccagataattcttcctttgaaataaatattacttccttctttaacaactcattg
gatgggaatggtaccactttcaataggacagtgagcatgtttaactgggatgaatatatt
gaggataaaagtcacttttattttttagaagggcaaaatgatgctctgctttgtggcaac
agctcagatgcaggccagtgtcctgaaggatacatctgtgtgaaggctggtagaaacccc
aactatggctacacgagctttgacacctttagttgggcctttttgtccctatttcgtctc
atgactcaagacttctgggaaaacctttatcaactgacactacgtgctgctgggaaaaca
tacatgatattttttgtgctggtcattttcttgggctcattctatctaataaatctgatc
ttggctgtggtggccatggcctatgaggaacagaatcaggccaccttggaagaggctgaa
cagaaggaagctgaatttcagcagatgctcgaacagttgaaaaagcaacaagaagaagct
caggcagcagctgcggccgcatctgctgaatcaagagacttcagtggtgctggtgggata
ggagttttttcagagagttcttcagtagcgtctaagttgagctccaaaagtgaaaaagag
ctgaaaaatagaagaaagaaaaagaaacagaaagaacagtctggagaagaagagaaaaac
gacagagtccgaaaatcggaatccgaagacagcataagaagaaaaggtttccgtttttcc
ttggaaggaagtaggctgacatatgaaaagagattttcttctccacaccagtccttactg
agcatccgtggctcccttttctctccaagacgcaacagtagggctagtcttttcagcttc
agaggtcgagcaaaggacattggctctgagaatgactttgctgatgatgagcacagcacc
tttgaggacaatgacagccgaagagactctctgtttgtgccgcacagacatggagaacgg
cgccacagcaacgtcagccaggccagtcgtgcctccagggtgctccccatcctgcccatg
aatgggaagatgcatagcgctgtggactgcaacggtgtggtctccctggtcgggggccct
tctaccctcacatctgctgggcagctcctaccagagggcacgactactgaaacagaaata
agaaagagacggtccagttcttatcatgtttccatggatttattggaagatcctacatca
aggcaaagagcaatgagtatagccagcattttgaccaacaccatggaagaacttgaagaa
tccagacagaaatgcccaccatgctggtataaatttgctaatatgtgtttgatttgggac
tgttgtaaaccatggttaaaggtgaaacaccttgtcaacctggttgtaatggacccattt
gttgacctggccatcaccatctgcattgtcttaaatacactcttcatggctatggagcac
tatcccatgacggagcagttcagcagtgtactgtctgttggaaacctggttttcacgggg
atcttcacagcagaaatgtttctgaagataattgccatggatccatattattactttcaa
gaaggctggaatatttttgatggttttattgtgagccttagtttaatggaacttggtctg
gcaaatgtggaaggattgtctgttctccgatcattccggctgctccgagttttcaagttg
gcaaaatcttggccaactctaaatatgctaataaagatcattggcaattctgtgggggct
ctaggaaacctcaccttggtgttggccatcatcgtcttcatttttgctgtggttggcatg
cagctctttggtaagagctacaaagaatgtgtctgcaagatttccaatgattgtgaactc
ccacgctggcacatgcatgacttcttccactccttcctgatcgtgttccgcgtgctgtgt
ggagagtggatagagaccatgtgggactgtatggaggtcgctggccaaaccatgtgcctt
actgtcttcatgatggtcatggtgattggaaatctagtggttctgaacctcttcttggcc
ttgcttttgagttccttcagttctgacaatctggctgccactgatgacgataacgaaatg
aataatctccagattgctgtgggaaggatgcagaaaggaatcgattttgttaaaagaaaa
atacgtgaatttattcagaaagcctttgttaggaaacagaaagctttagatgaaattaaa
cctcttgaagatctaaataataaaaaagacagctgtatttccaatcataccaccatagaa
ataggcaaagacctcaattatctcaaagatggaaatggaactactagtggcataggcagc
agtgtagaaaaatatgtcgtggatgaaagtgattacatgtcatttataaacaaccctagc
ctcactgtgacggtaccaattgctgttggagaatctgactttgaaaatttaaatactgaa
gaattcagcagcgagtcagatatggaggaaagcaaagagaagctaaatgcaactagttca
tctgaaggcagcacggttgatataggagctcctgccgagggagaacaacctgaggttgaa
cctgaggaatcccttgaacctgaagcctgttttacagaagactgtgtacggaagttcaag
tgttgtcagataagcatagaagaaggcaaagggaaactctggtggaatttgaggaaaaca
tgctataagatagtggagcacaattggttcgaaaccttcattgtcttcatgattctgctg
agcagtggggctctggcctttgaagatatatacattgagcagcgaaaaaccattaagacc
atgttagaatatgctgacaaggttttcacttacatattcatcctggaaatgctgctaaag
tgggttgcatatggttttcaagtgtattttaccaatgcctggtgctggctagacttcctg
attgttgatgtctcattggttagcttaactgcaaatgccttgggttactcagaacttggt
gccatcaaatccctcagaacattaagagctctgaggccactgagagccttgtcccgattt
gaaggaatgagggttgttgtaaatgctcttttaggagccattccatctatcatgaatgta
cttctggtttgtctgatcttttggctaatattcagtataatgggagtgaatctctttgct
ggcaagttttaccattgtattaactacaccactggagagatgttcgatgtaagcgtggtt
aacaactacagtgagtgcaaagctctcattgagagcaatcaaactgccaggtggaaaaat
gtgaaagtaaactttgataacgtgggacttggatatctgtctctacttcaagtagccacg
tttaagggatggatggatattatgtatgcagctgttgactcaagaaatgtagaattgcaa
cccaagtatgaagacaacctgtacatgtatctttattttgtcatctttattatttttggt
tcattctttaccttgaatcttttcattggtgtcatcatagacaacttcaaccaacagaaa
aagaagtttggaggtcaagacatttttatgacagaagaacagaagaaatactacaatgca
atgaaaaaactgggttcaaagaaaccacaaaaacccatacctcgacctgctaacaaattc
caaggaatggtctttgattttgtaaccaaacaagtctttgatatcagcatcatgatcctc
atctgccttaacatggtcaccatgatggtggaaaccgatgaccagagtcaagaaatgaca
aacattctgtactggattaatctggtgtttattgttctgttcactggagaatgtgtgctg
aaactgatctctcttcgttactactatttcactattggatggaatatttttgattttgtg
gtggtcattctctccattgtaggaatgtttctggctgaactgatagaaaagtattttgtg
tcccctaccctgttccgagtgatccgtcttgccagaattggccgaatcctacgtctgatc
aaaggagcaaaggggatccgcacgctgctctttgctttgatgatgtccctccctgcattg
tttaacatcggcctcctgctcttcctggtcatgttcatctacgccatctttgggatgtcc
aactttgcctatgttaagagggaagttgggatcgatgacatgttcaactttgagaccttt
ggcaacagcatgatctgcctgtttcaaattacaacctctgctggttgggatggactgcta
gcacctattcttaatagtggacctccagactgtgaccctgaaaaagatcaccctggaagc
tcagttaagggagattgtgggaacccatctgttgggattttcttttttgtcagttacatc
atcatatccttcctggttgtggtgaacatgtacatcgcagtcatcctggagaacttcagt
gttgctactgaggaaagtgcagagcccctgagtgaggatgactttgagatgttctatgag
gtttgggagaagtttgatcccgatgcgacccagtttatagagtttgccaagctctctgat
tttgcagacgccctggatcctcctcttctcatagcaaaacccaacaaagtccagctcatt
gccatggatctgcccatggtcagcggtgaccggatccactgcctcgacatcttatttgct
tttacaaagcgtgttttgggtgagagtggagagatggatgcccttcgaatacagatggaa
gagcgattcatggcatcaaacccctccaaaatctcttatgagcccattacgaccacgttg
aaacgcaaacaagaggaggtgtcggctattattatccagagggcttacagacgctacctc
ttgaagcaaaaagttaaaaaggtatcaagtatatacaagaaagacaaaggcaaagaatgt
gacggaacacctatcaaagaagatactctcattgataaactgaatgagaattcaactcca
gagaaaaccgatatgacgccttccaccacatctccaccctcgtatgatagtgtgaccaaa
ccagaaaaagaaaaatttgaaaaagacaaatcagaaaaggaagacaaagggaaagatatc
agggaaagtaaaaagtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663918
Entry
104663918         CDS       T03989                                 

Definition
(RefSeq) sodium channel protein type 3 subunit alpha
  KO
K04836  voltage-gated sodium channel type III alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104663918
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104663918
Ion channels [BR:rro04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   104663918
SSDB
Motif
Pfam: Ion_trans Na_trans_assoc Na_trans_cytopl PKD_channel ATP-synt_B GPHH SieB IQ
Other DBs
NCBI-GeneID: 104663918
NCBI-ProteinID: XP_030772713
LinkDB
Position
14
AA seq 1951 aa
MAQALLVPPGPESFRLFTRESLAAIEKRAAEEKAKKPKKEQDNDDENKPKPNSDLEAGKN
LPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVMNKGKAIFRFSATSALYILTPLNPVRKI
AIKILVHSLFSMLIMCTILTNCVFMTLSNPPDWTKNVEYTFTGIYTFESLIKILARGFCL
EDFTFLRDPWNWLDFSVIVMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGAL
IQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPSDSAFETNTTSYFNGTMD
SNGTFVNVTMSTFNWKDYIGDDSHFYVLDGQKDPLLCGNGSDAGQCPEGYICVKAGRNPN
YGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLVNLIL
AVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAVAAASAASRDFSGIGGLGE
LLESSSEASKLSSKSAKEWRNRRKKRRQREHREGNNKGERDSFPKSESEDSVKRSSFLFS
MDGNRLTSDKKFCSPHQSLLSIRGSLFSPRRNSKTSIFSFRGRAKDVGSENDFADDEHST
FEDSESRRDSLFVPHRHGERRNSNGTTTETEVRKRRLSSYQISMEVLEDSSGRQRAMSIA
SILTNTMEELEESRQKCPPCWYRFANVFLIWDCCDVWLKVKHLVNLIVMDPFVDLAITIC
IVLNTLFMAMEHYPMTEQFSSVLTVGNLVFTGIFTAEMVLKIIAMDPYYYFQEGWNIFDG
IIVSLSLMELGLSNVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVL
AIIVFIFAVVGMQLFGKSYKECVCKINDDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMW
DCMEVAGQTMCLIVFMLVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVG
RMQKGIDYVKNKIRECFRKAFFRKPKVIEIHEGNKIDSCMSNNTGIEISKELNYLRDGNG
TTSGVGTGSSVEKYVIDENDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESELEES
KEKLNATSSSEGSTVDVALPREGEQAEIEPEEDLKPEACFTEGCIKKFPFCQVSTEEGKG
KIWWNLRKTCYSIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTY
IFILEMLLKWVAYGFQTYFTNAWCWLDFLIVDVSLVSLVANALGYSELGAIKSLRTLRAL
RPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNMTT
GNMFDVSDVNNLSDCQALGKQARWKNVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDS
RDVTLQPMYEENLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQ
KKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTRQVFDISIMILICLNMVTMMVETDD
QGKYMTLVLSRINLVFIVLFTGEFVLKLVSLRHYYFTIGWNIFDFVVVILSIVGMFLAEM
IEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIY
AIFGMSNFAYVKKEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSAPPDCDPD
TIHPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDD
FEMFYEVWEKFDPDATQFIEFSKLSDFAAALDPPLLIPKPNKVQLIAMDLPMVSGDRIHC
LDILFAFTKRVLGESGEMDALRIQMEDRFMSSNPSKVSYEPITTTLKRKQEEVSAAIIQR
NFRCYLLKQRLKNISSNYNKEAIKGRIDLPIKQDMIIDKLNGNSTPEKSDGSSSTTSPPS
YDSVTKPDKEKFEKDKPEKESKVKEVRENQK
NT seq 5856 nt   +upstreamnt  +downstreamnt
atggcacaggcactgttggtacccccgggacctgaaagcttccgcctttttactagagaa
tctcttgctgctatcgaaaaacgtgctgcagaagagaaagccaagaaacccaaaaaggaa
caagataatgatgatgagaacaaaccaaagccaaatagtgacttggaagctggaaagaac
cttccatttatttatggagacattcctccagagatggtgtcagagcccctggaggatctg
gacccctactatatcaataagaaaacttttatagtaatgaataaaggaaaggcaattttc
cgattcagtgccacctctgccttgtatattttaactccactaaaccctgttaggaaaatt
gctatcaagattttggtacattctttattcagcatgcttatcatgtgcactattttgacc
aactgtgtatttatgaccttgagtaaccctcccgactggacaaagaatgtagagtacaca
ttcacgggaatctatacctttgagtcacttataaaaatcttggcaagagggttttgctta
gaagattttacatttcttcgtgatccatggaactggctggatttcagtgtcattgtgatg
gcatatgtgacagagtttgtggacctgggcaatgtctcagcgttgagaacattcagagtt
ctccgagcattgaaaacaatttcagtcattccaggtttaaagaccattgtgggggccctg
atccagtcggtgaagaagctttctgacgtcatgatcctgactgtgttctgtctgagcgtg
tttgctctcattgggctgcagctgttcatgggcaacctgaggaataaatgtttgcagtgg
cccccaagcgattctgcttttgaaaccaacaccacctcctactttaatggcacaatggat
tcaaatgggacatttgttaatgtaacaatgagcacatttaactggaaggattacattgga
gatgacagtcacttttatgttttggatggacaaaaagaccctttactctgtggaaacggc
tcagatgcaggccagtgtccagaaggatatatctgcgtgaaggctggtcgaaaccccaac
tatggctacacaagctttgacacctttagctgggctttcctgtctctatttcgacttatg
acccaagactactgggagaatctttaccagttgacattacgtgctgctgggaaaacatac
atgatattttttgtcctggtcattttcttgggctcattttatttggtgaatttgatcctg
gctgtggtggccatggcctatgaggaacagaatcaggccacactggaagaagcagaacaa
aaagaggctgaatttcagcagatgctcgaacagcttaaaaagcaacaggaagaagctcag
gcagttgcggcagcatccgctgcttcaagagatttcagtggaataggtgggttaggcgag
ttgttggaaagttcttcagaagcatcaaagttaagctccaaaagtgctaaagaatggagg
aaccgaaggaagaaaagaagacagagggagcaccgtgaaggaaacaataaaggagagaga
gacagctttcctaaatccgaatctgaagacagtgtcaaaagaagcagcttccttttctcc
atggatggaaacagactgaccagtgacaagaaattctgctcccctcatcagtctctgttg
agtatccgtggctccctgttttccccaaggcgcaatagcaaaacaagcattttcagtttc
agaggtcgggcaaaggatgttggatctgaaaatgactttgctgatgacgaacacagcaca
tttgaagacagcgaaagcaggagagactcactgtttgtgccgcacagacatggagagcga
cgcaacagtaacggcaccaccactgaaacggaagtcagaaagagaaggttaagttcttac
cagatttcaatggaggtgctggaggattcctctggaaggcaaagagccatgagcatagcc
agcattctgaccaacacaatggaagaacttgaagaatctagacagaaatgtccaccatgc
tggtatagatttgccaatgtgttcttgatctgggactgctgtgatgtatggttaaaagta
aaacatcttgtgaatttaattgttatggatccatttgttgatcttgccatcactatttgc
atagtcttaaataccctctttatggccatggagcactaccctatgaccgagcaattcagt
agtgtattgactgtaggaaacctggtcttcactgggattttcacagcagaaatggttctc
aagatcattgccatggatccttattactatttccaagagggctggaatatctttgatgga
attattgtcagcctgagtttaatggagcttggtctatcaaatgtggagggattgtctgta
ctgcgatcattcagactgcttagagttttcaagttggcaaaatcctggcccacactaaat
atgctaattaagatcattggcaattctgtgggggctctaggaaacctcaccttggtattg
gccatcatcgtcttcatttttgctgtggtcggcatgcagctctttggtaagagctacaaa
gaatgtgtctgcaagatcaatgatgactgtacgctcccacggtggcacatgaacgacttc
ttccactccttcctgattgtgttccgcgtgctgtgtggagagtggatagagaccatgtgg
gactgtatggaggttgctggccaaaccatgtgccttattgttttcatgttggtcatggtc
attggaaaccttgtggttctgaacctctttctggccttattgttgagttcatttagctca
gacaaccttgctgctactgatgatgacaatgaaatgaataatctgcagattgcagtagga
agaatgcaaaagggaatcgattatgtgaaaaataagatacgggagtgtttccgaaaagcc
ttttttagaaaaccaaaagttatagaaatccatgaaggcaataagatagacagctgcatg
tccaataatactggaattgaaataagcaaagagcttaattatcttagagatgggaatgga
accaccagtggtgtaggtaccggaagcagtgttgaaaaatacgtaatcgatgaaaatgat
tatatgtcattcataaacaaccccagcctcactgtaacagtgccaattgctgttggagag
tctgactttgaaaacttaaatactgaagagttcagcagtgagtcagaactagaagaaagc
aaagagaaattaaatgcaaccagctcatctgaaggaagcacagttgatgttgctctaccc
cgagaaggtgaacaagctgaaattgaacccgaagaagatcttaaaccagaagcttgtttt
actgaaggatgtattaaaaagtttccattctgtcaagtaagtacagaagaaggcaaagga
aagatctggtggaatcttcggaaaacctgctacagcattgttgagcacaactggtttgag
actttcattgtgttcatgatccttctcagtagtggtgctttggcctttgaagatatatac
attgaacagcgaaagactatcaaaaccatgctagaatatgctgacaaagtcttcacctat
atattcattctggaaatgcttctcaaatgggttgcttatggatttcaaacatatttcact
aatgcctggtgctggctagatttcttgattgttgatgtttctttggttagcctggtagcc
aatgctcttggttactcagaactcggtgccatcaaatcattacggacattaagagctttg
agacctctaagagccttatcccggtttgaaggcatgagggtggttgtgaatgctcttgtt
ggagcaattccctctatcatgaacgtgctgttggtctgtctcatcttctggctgatcttt
agcattatgggtgtgaatttgtttgctggcaagttctaccactgtgttaacatgacaacg
ggtaacatgtttgacgttagtgatgtcaacaatttgagtgactgtcaggctcttggcaag
caagctcggtggaaaaacgtgaaagtaaactttgataatgttggcgctggctatctcgca
ctgcttcaagtggccacatttaaaggctggatggatattatgtatgcagctgttgattca
cgagatgttacacttcagcctatgtatgaggaaaatctgtacatgtatttatactttgtc
atctttatcatcttcgggtcattcttcactctgaatctattcattggtgtcatcatagat
aacttcaaccagcagaaaaagaagtttggaggtcaagacatctttatgacagaggaacag
aaaaaatattacaatgcaatgaagaaacttggatccaagaaacctcagaaacccatacct
cgcccagcaaacaaattccaaggaatggtctttgattttgtaaccaggcaagtctttgat
atcagcatcatgatactcatctgcctcaatatggtcaccatgatggtggaaaccgacgac
cagggcaaatatatgaccctagttttgtcccggatcaacctagtgttcattgttctgttc
actggagaatttgtgctgaagctcgtctccctcagacactactacttcactataggctgg
aacatctttgattttgtggtggtgattctctccattgtaggtatgtttctggctgagatg
atagaaaagtattttgtgtcccctaccctgttccgagtgatccgtcttgccagaattggc
cgaatcctacgtctgatcaaaggagcaaaggggatccgcacgctgctctttgctttgatg
atgtccctccctgcattgtttaacatcggcctcctgctcttcctggtcatgttcatctat
gccatctttgggatgtccaactttgcctatgttaaaaaggaagctggaattgatgacatg
ttcaactttgagacctttggcaacagcatgatctgcttgttccaaattacaacctctgct
ggctgggatggattgctagcacctattcttaatagtgcaccacccgactgtgaccctgac
acaattcatcctggcagctcagttaagggagactgtgggaacccatctgttgggattttc
ttttttgtcagttacatcatcatatccttcctggttgtggtgaacatgtacatcgcggtc
atcctggagaacttcagtgttgctactgaagaaagtgcagagcccctgagtgaggatgac
ttcgagatgttctatgaggtttgggaaaagtttgatcccgatgcgacccagtttatagag
ttctctaagctctctgattttgcagctgccctggatcctcctcttctcataccaaaaccc
aacaaagtccagcttattgccatggatctgcccatggtcagtggtgaccggatccactgc
cttgatattttatttgcctttacaaaacgtgttttgggtgagagtggagagatggatgcc
cttcgaatacagatggaagaccggtttatgtcatcaaacccctccaaagtctcttatgag
cctattacaaccactttgaaacgtaaacaagaggaggtgtctgccgctatcattcagcgt
aatttcagatgttatcttttaaagcaaaggttaaaaaatatatcaagtaactataacaaa
gaggcaattaaagggaggattgacttacctataaaacaagacatgattattgacaaatta
aatgggaactccactccagaaaaatcagatgggagttcctctaccacctctcctccttcc
tatgatagtgtaacaaaaccagacaaagaaaagtttgagaaagacaaaccagaaaaagaa
agcaaagtaaaagaggtcagagaaaatcaaaagtaa

DBGET integrated database retrieval system