KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663916
Entry
104663916         CDS       T03989                                 

Gene name
SCN2A
Definition
(RefSeq) sodium channel protein type 2 subunit alpha isoform X1
  KO
K04834  voltage-gated sodium channel type II alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104663916 (SCN2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104663916 (SCN2A)
Ion channels [BR:rro04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   104663916 (SCN2A)
SSDB
Motif
Pfam: Ion_trans Na_trans_cytopl Na_trans_assoc PKD_channel GPHH ATP-synt_B IQ
Other DBs
NCBI-GeneID: 104663916
NCBI-ProteinID: XP_010363608
UniProt: A0A2K6R0F9
LinkDB
Position
14
AA seq 2005 aa
MAQSVLVPPGPDSFRFFTRESLAAIEQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGK
SLPFIYGDIPPEMVSVPLEDLDPYYINKKTFIVLNKGKAISRFSATPALYILTPFNPIRK
LAIKILVHSLFNMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFC
LEDFTFLRDPWNWLDFTVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGA
LIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSSFEINITSFFNNSL
DGNGTTFNRTVSMFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNP
NYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLI
LAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAAAAAASAESRDFSGAGGI
GVFSESSSVASKLSSKSEKELKNRRKKKKQKEQSGEEEKNDRVRKSESEDSIRRKGFRFS
LEGSRLTYEKRFSSPHQSLLSIRGSLFSPRRNSRASLFSFRGRAKDIGSENDFADDEHST
FEDNDSRRDSLFVPHRHGERRHSNVSQASRASRVLPILPMNGKMHSAVDCNGVVSLVGGP
STLTSAGQLLPEGTTTETEIRKRRSSSYHVSMDLLEDPTSRQRAMSIASILTNTMEELEE
SRQKCPPCWYKFANMCLIWDCCKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEH
YPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGL
ANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGM
QLFGKSYKECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCL
TVFMMVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDFVKRK
IREFIQKAFVRKQKALDEIKPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIGS
SVEKYVVDESDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESDMEESKEKLNATSS
SEGSTVDIGAPAEGEQPEVEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKT
CYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLK
WVAYGFQVYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRF
EGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVV
NNYSECKALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQ
PKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNA
MKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMT
NILYWINLVFIVLFTGECVLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFV
SPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMS
NFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPEKDHPGS
SVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYE
VWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFA
FTKRVLGESGEMDALRIQMEERFMASNPSKISYEPITTTLKRKQEEVSAIIIQRAYRRYL
LKQKVKKVSSIYKKDKGKECDGTPIKEDTLIDKLNENSTPEKTDMTPSTTSPPSYDSVTK
PEKEKFEKDKSEKEDKGKDIRESKK
NT seq 6018 nt   +upstreamnt  +downstreamnt
atggcacagtcagtgctggtaccgccaggacctgacagcttccgcttctttaccagggaa
tcccttgctgctattgaacaacgcattgcagaagagaaagctaagagacccaaacaggaa
cgcaaggatgaggatgatgaaaatggcccaaagccaaacagtgacttggaagcaggaaaa
tctcttccatttatttatggagacattcctccagagatggtgtcagtgcccctggaggat
ctggacccctactatatcaataagaaaacgtttatagtattgaataaagggaaagcaatc
tctcgattcagtgccacccccgccctttacattttaactcccttcaaccctattagaaaa
ttagctattaagattttggtacattctttattcaatatgctcattatgtgcactattctt
accaactgtgtatttatgaccatgagtaaccctccagactggacaaagaatgtggagtat
acctttacaggaatttatacttttgaatcacttattaaaatacttgcaaggggcttttgt
ttagaagatttcacatttttacgggatccatggaattggttggatttcacagtcattact
tttgcatatgtgacagagtttgtggacctgggcaatgtctcagcgttgagaacattcaga
gttctccgagcattgaaaacaatttcagtcattccaggcctgaagaccattgtgggggcc
ctgatccagtcagtgaagaagctttctgatgtcatgatcttgactgtgttctgtctaagc
gtgtttgcgctaataggattacagttgttcatgggcaacctacgaaataaatgtttgcaa
tggcctccagataattcttcctttgaaataaatattacttccttctttaacaactcattg
gatgggaatggtaccactttcaataggacagtgagcatgtttaactgggatgaatatatt
gaggataaaagtcacttttattttttagaagggcaaaatgatgctctgctttgtggcaac
agctcagatgcaggccagtgtcctgaaggatacatctgtgtgaaggctggtagaaacccc
aactatggctacacgagctttgacacctttagttgggcctttttgtccctatttcgtctc
atgactcaagacttctgggaaaacctttatcaactgacactacgtgctgctgggaaaaca
tacatgatattttttgtgctggtcattttcttgggctcattctatctaataaatctgatc
ttggctgtggtggccatggcctatgaggaacagaatcaggccaccttggaagaggctgaa
cagaaggaagctgaatttcagcagatgctcgaacagttgaaaaagcaacaagaagaagct
caggcagcagctgcggccgcatctgctgaatcaagagacttcagtggtgctggtgggata
ggagttttttcagagagttcttcagtagcgtctaagttgagctccaaaagtgaaaaagag
ctgaaaaatagaagaaagaaaaagaaacagaaagaacagtctggagaagaagagaaaaac
gacagagtccgaaaatcggaatccgaagacagcataagaagaaaaggtttccgtttttcc
ttggaaggaagtaggctgacatatgaaaagagattttcttctccacaccagtccttactg
agcatccgtggctcccttttctctccaagacgcaacagtagggctagtcttttcagcttc
agaggtcgagcaaaggacattggctctgagaatgactttgctgatgatgagcacagcacc
tttgaggacaatgacagccgaagagactctctgtttgtgccgcacagacatggagaacgg
cgccacagcaacgtcagccaggccagtcgtgcctccagggtgctccccatcctgcccatg
aatgggaagatgcatagcgctgtggactgcaacggtgtggtctccctggtcgggggccct
tctaccctcacatctgctgggcagctcctaccagagggcacgactactgaaacagaaata
agaaagagacggtccagttcttatcatgtttccatggatttattggaagatcctacatca
aggcaaagagcaatgagtatagccagcattttgaccaacaccatggaagaacttgaagaa
tccagacagaaatgcccaccatgctggtataaatttgctaatatgtgtttgatttgggac
tgttgtaaaccatggttaaaggtgaaacaccttgtcaacctggttgtaatggacccattt
gttgacctggccatcaccatctgcattgtcttaaatacactcttcatggctatggagcac
tatcccatgacggagcagttcagcagtgtactgtctgttggaaacctggttttcacgggg
atcttcacagcagaaatgtttctgaagataattgccatggatccatattattactttcaa
gaaggctggaatatttttgatggttttattgtgagccttagtttaatggaacttggtctg
gcaaatgtggaaggattgtctgttctccgatcattccggctgctccgagttttcaagttg
gcaaaatcttggccaactctaaatatgctaataaagatcattggcaattctgtgggggct
ctaggaaacctcaccttggtgttggccatcatcgtcttcatttttgctgtggttggcatg
cagctctttggtaagagctacaaagaatgtgtctgcaagatttccaatgattgtgaactc
ccacgctggcacatgcatgacttcttccactccttcctgatcgtgttccgcgtgctgtgt
ggagagtggatagagaccatgtgggactgtatggaggtcgctggccaaaccatgtgcctt
actgtcttcatgatggtcatggtgattggaaatctagtggttctgaacctcttcttggcc
ttgcttttgagttccttcagttctgacaatctggctgccactgatgacgataacgaaatg
aataatctccagattgctgtgggaaggatgcagaaaggaatcgattttgttaaaagaaaa
atacgtgaatttattcagaaagcctttgttaggaaacagaaagctttagatgaaattaaa
cctcttgaagatctaaataataaaaaagacagctgtatttccaatcataccaccatagaa
ataggcaaagacctcaattatctcaaagatggaaatggaactactagtggcataggcagc
agtgtagaaaaatatgtcgtggatgaaagtgattacatgtcatttataaacaaccctagc
ctcactgtgacggtaccaattgctgttggagaatctgactttgaaaatttaaatactgaa
gaattcagcagcgagtcagatatggaggaaagcaaagagaagctaaatgcaactagttca
tctgaaggcagcacggttgatataggagctcctgccgagggagaacaacctgaggttgaa
cctgaggaatcccttgaacctgaagcctgttttacagaagactgtgtacggaagttcaag
tgttgtcagataagcatagaagaaggcaaagggaaactctggtggaatttgaggaaaaca
tgctataagatagtggagcacaattggttcgaaaccttcattgtcttcatgattctgctg
agcagtggggctctggcctttgaagatatatacattgagcagcgaaaaaccattaagacc
atgttagaatatgctgacaaggttttcacttacatattcatcctggaaatgctgctaaag
tgggttgcatatggttttcaagtgtattttaccaatgcctggtgctggctagacttcctg
attgttgatgtctcattggttagcttaactgcaaatgccttgggttactcagaacttggt
gccatcaaatccctcagaacattaagagctctgaggccactgagagccttgtcccgattt
gaaggaatgagggttgttgtaaatgctcttttaggagccattccatctatcatgaatgta
cttctggtttgtctgatcttttggctaatattcagtataatgggagtgaatctctttgct
ggcaagttttaccattgtattaactacaccactggagagatgttcgatgtaagcgtggtt
aacaactacagtgagtgcaaagctctcattgagagcaatcaaactgccaggtggaaaaat
gtgaaagtaaactttgataacgtgggacttggatatctgtctctacttcaagtagccacg
tttaagggatggatggatattatgtatgcagctgttgactcaagaaatgtagaattgcaa
cccaagtatgaagacaacctgtacatgtatctttattttgtcatctttattatttttggt
tcattctttaccttgaatcttttcattggtgtcatcatagacaacttcaaccaacagaaa
aagaagtttggaggtcaagacatttttatgacagaagaacagaagaaatactacaatgca
atgaaaaaactgggttcaaagaaaccacaaaaacccatacctcgacctgctaacaaattc
caaggaatggtctttgattttgtaaccaaacaagtctttgatatcagcatcatgatcctc
atctgccttaacatggtcaccatgatggtggaaaccgatgaccagagtcaagaaatgaca
aacattctgtactggattaatctggtgtttattgttctgttcactggagaatgtgtgctg
aaactgatctctcttcgttactactatttcactattggatggaatatttttgattttgtg
gtggtcattctctccattgtaggaatgtttctggctgaactgatagaaaagtattttgtg
tcccctaccctgttccgagtgatccgtcttgccagaattggccgaatcctacgtctgatc
aaaggagcaaaggggatccgcacgctgctctttgctttgatgatgtccctccctgcattg
tttaacatcggcctcctgctcttcctggtcatgttcatctacgccatctttgggatgtcc
aactttgcctatgttaagagggaagttgggatcgatgacatgttcaactttgagaccttt
ggcaacagcatgatctgcctgtttcaaattacaacctctgctggttgggatggactgcta
gcacctattcttaatagtggacctccagactgtgaccctgaaaaagatcaccctggaagc
tcagttaagggagattgtgggaacccatctgttgggattttcttttttgtcagttacatc
atcatatccttcctggttgtggtgaacatgtacatcgcagtcatcctggagaacttcagt
gttgctactgaggaaagtgcagagcccctgagtgaggatgactttgagatgttctatgag
gtttgggagaagtttgatcccgatgcgacccagtttatagagtttgccaagctctctgat
tttgcagacgccctggatcctcctcttctcatagcaaaacccaacaaagtccagctcatt
gccatggatctgcccatggtcagcggtgaccggatccactgcctcgacatcttatttgct
tttacaaagcgtgttttgggtgagagtggagagatggatgcccttcgaatacagatggaa
gagcgattcatggcatcaaacccctccaaaatctcttatgagcccattacgaccacgttg
aaacgcaaacaagaggaggtgtcggctattattatccagagggcttacagacgctacctc
ttgaagcaaaaagttaaaaaggtatcaagtatatacaagaaagacaaaggcaaagaatgt
gacggaacacctatcaaagaagatactctcattgataaactgaatgagaattcaactcca
gagaaaaccgatatgacgccttccaccacatctccaccctcgtatgatagtgtgaccaaa
ccagaaaaagaaaaatttgaaaaagacaaatcagaaaaggaagacaaagggaaagatatc
agggaaagtaaaaagtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104678069
Entry
104678069         CDS       T03989                                 

Gene name
HCN4
Definition
(RefSeq) potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
  KO
K04957  hyperpolarization activated cyclic nucleotide-gated potassium channel 4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04024  cAMP signaling pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    104678069 (HCN4)
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104678069 (HCN4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104678069 (HCN4)
Ion channels [BR:rro04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (HCN)
   104678069 (HCN4)
SSDB
Motif
Pfam: Ion_trans Ion_trans_N cNMP_binding Ion_trans_2
Other DBs
NCBI-GeneID: 104678069
NCBI-ProteinID: XP_030786985
LinkDB
Position
5
AA seq 1203 aa
MDKLPPSMRKRLYSLPQQVGAKAWIMDEEEDAEEEGAGGRQDPSRRSIRLRPLPSPSPSA
AAGGTESRSSALGAADSEGPARGAGKSSTNGDCRRFRGSLASLGSRGGGGSGTGSGSSHG
HLHDSAEERRLIAEGDASPGEDRTPPGLAAEPERPGASAQPAASPPPPQQPPQPASSSCE
QPSADTAIKVEGGAATGDQILPEAEVRLGQSGFMQRQFGAMLQPGVNKFSLRMFGSQKAV
EREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNV
VSDTFFLIDLVLNFRTGIVVEDNTEIILDPQRIKMKYLKSWFMVDFISSIPVDYIFLIVE
TRIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVN
LIGMMLLLCHWDGCLQFLVPMLQDFPDDCWVSINNMVNNSWGKQYSYALFKAMSHMLCIG
YGRQAPVGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSF
HKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANAD
PNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGE
ICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSI
LLHKVQHDLNSGVFNYQENEIIQQIVQHDREMAHCAHRVQAAASATPTPTPVIWTPLIQA
PLQAAAATTSVAIALTHHPRLPAAIFRPPPGSGLGNLGAGQTPRHLKRLQSLIPSALGSA
SPASSPSQVDTPSSSSFHIQQLAGFSAPAGLSPLLPSSSSSPPPGACGSPSAPTPSAGTA
ATTTAGFGQFHKALGGSLSSSDSPLLTPLQPGARSPQAAQPPPAPPGARGGLGLPEHFLP
PPPSSRSPSSSSGQLGQPPGELSLGLAAGPPSTPETPPRQPEPPSLVAGASGGASPVGFT
PRGGLSPPGHSPGPPRTFPSAPPRASGSHGSLLLPPASSPPPPQVPQRRGTPPLTPGRLT
QDLKLISASQPALPQDGAQTLRRASPHSSGESMAAFPLFPRAGAGSGGSGSSGGLGPPGR
PYGAIPGQHVTLPRKTSSGSLPPPLSLFGARATSSGGPRLTAGPQREPGARPEPVRSKLP
SNL
NT seq 3612 nt   +upstreamnt  +downstreamnt
atggacaagctgccaccgtccatgcgcaagcggctctacagtctcccgcagcaggtgggg
gccaaggcgtggatcatggacgaggaagaggacgcagaggaggagggggccgggggccgc
caagaccccagccgcaggagcatccggctgcggccactgccctcgccctcgccctcggcg
gccgcgggtggtacggagtcccggagctcggccctcggggcagcggacagcgaagggccg
gcccgcggcgcgggcaagtccagcacgaacggcgactgcaggcgcttccgcgggagcctg
gcctcgctgggcagccggggcggcggcggcagcggcacggggagcggcagcagtcacgga
cacctgcatgactccgcggaggagcggcggcttatcgccgagggcgacgcgtcccccggc
gaggacaggacgcccccaggcctggcggccgagcccgagcgccccggcgcctcagcgcag
cccgcagcctcgccgccgccgccccagcagccaccgcagccggcctcctcctcctgcgag
cagccctcggcggacaccgctatcaaagtggagggaggcgcggccaccggcgaccagatc
cttccggaggccgaggtgcgcttgggccagtccggcttcatgcagcgccagttcggggcc
atgctccaacccggggtgaacaaattctccctaaggatgttcggcagccagaaagccgtg
gaacgcgagcaggagagggtcaagtcggccggattttggattatccacccctacagtgac
ttcagattttactgggacctgaccatgctgctgctgatggtgggaaacctgatcatcatt
cctgtgggcatcaccttcttcaaggatgagaacaccacaccctggattgtcttcaatgtg
gtgtcagacacattcttcctcatcgacttggtcctcaacttccgcacagggatcgtggtg
gaggacaacacagagatcatcctggacccgcagcggattaaaatgaagtacctgaaaagc
tggttcatggtagatttcatttcctccatccccgtggactatatcttcctcattgtggag
acacgcattgactcagaggtctacaagactgcccgggccctgcgcatcgtccgcttcacg
aagatcctcagcctcttacgcctgttacgcctctcccgcctcattcgatatattcaccag
tgggaagagatcttccacatgacctacgacctggccagcgccgtggtgcgcatcgtgaac
ctcatcggcatgatgctcctgctctgccactgggatggctgcctgcagttcctggtaccc
atgctgcaggacttccctgatgactgctgggtgtccatcaacaacatggtgaacaactcc
tgggggaagcagtactcctacgcgctcttcaaggccatgagccacatgctgtgcatcggc
tatggacggcaggcgcccgtgggcatgtccgacgtctggctcaccatgctcagcatgatc
gtgggcgccacctgctatgccatgttcattggccacgccactgccctcatccagtccctg
gactcctcccggcgccagtaccaggaaaagtataagcaggtggagcagtacatgtccttc
cacaagctcccgcccgacacccggcagcgcatccacgactactacgagcaccgctaccag
ggcaagatgttcgatgaggagagcatcctgggcgagctgagcgagcccctgcgggaggag
atcatcaactttaactgccggaaactggtggcctccatgccactgtttgccaacgcggac
cccaacttcgtgacgtccatgctgaccaagctgcgtttcgaggtcttccagcctggggac
tacatcatccgggaaggcaccatcggcaagaagatgtacttcattcagcacggcgtggtc
agcgtgctcaccaagggcaacaaggagaccaagctggccgacggctcctactttggagag
atctgcctgctgacacggggccggcgcacagccagcgtgagggccgacacctactgccgc
ctctactcgctgagcgtggacaacttcaatgaggtgctggaggagtaccccatgatgcga
agggcctttgagactgtggcgctggaccgcctggaccgcatcggcaagaagaactccatc
ctcctccacaaagtccagcacgacctcaactcgggcgtcttcaactaccaggagaacgag
atcatccagcagattgtgcagcatgaccgggagatggcgcactgcgcacaccgcgtccag
gctgccgcctctgccaccccgacccccacacctgtcatctggaccccgctgatacaggca
ccactgcaggctgccgctgccaccacttctgtggccatagccctcacccaccaccctcgc
ctgcctgctgccatcttccgccctcccccaggatctgggctgggcaatctcggtgccggg
cagacaccaaggcacctgaaacggctgcagtccctgatcccttctgcgctgggctccgcc
tcacccgccagcagcccatcccaggtagacacgccgtcttcatcctccttccacatccaa
cagctggctggattctctgcccccgctggactgagcccactcctgccctcatccagctcc
tccccaccccccggggcctgtggctccccctcggctcccacaccatcagctggcacagcc
gccaccaccacagccgggtttggccagttccacaaggcactgggtggctccctgtcctcc
tccgactctcccctgctcaccccgctgcagccaggtgcccgctccccgcaggctgcccag
ccacctcccgcaccacccggggcccggggaggcctgggactcccggagcacttcctgcca
cccccaccctcatccagatccccatcatctagctctgggcagctgggccagcctcccggg
gagttgtccctaggtctagctgctggcccaccgagcacgccagagacacccccacggcag
cctgagccgccatcccttgtggcaggggcctctgggggggcttcccctgtaggctttact
ccccgaggaggtctcagcccccctggccacagcccaggccccccaagaaccttcccaagt
gccccgccccgggcctctggctcccacggatccttgcttctgccacctgcatccagcccc
ccaccaccccaggtcccccagcgccggggcacgccccccctcacccccggccgcctcacc
caggacctcaagctcatctctgcatctcagccagccctgcctcaagacggggcacagact
ctccgcagagcctccccgcactcctcaggggagtccatggctgccttcccgctcttcccc
agggctggggctggcagcgggggcagtgggagcagcgggggccttggtccccctgggagg
ccctatggtgccatccccggccagcacgtcactctgcctcggaagacatcctcaggttct
ttgccaccccctctgtctttgtttggggcaagagccacctcttctggggggccccgtctg
actgctggaccccagagggaacctggggccaggcctgagccagtgcgctccaaactgccg
tccaatctatga

DBGET integrated database retrieval system