KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663941
Entry
104663941         CDS       T03989                                 

Gene name
NKX2-1
Definition
(RefSeq) homeobox protein Nkx-2.1 isoform X1
  KO
K09342  homeobox protein Nkx-2.1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104663941 (NKX2-1)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: NKL
    104663941 (NKX2-1)
SSDB
Motif
Pfam: Homeodomain SARAF Homeobox_KN
Other DBs
NCBI-GeneID: 104663941
NCBI-ProteinID: XP_010363633
UniProt: A0A2K6NIF7
LinkDB
Position
5
AA seq 401 aa
MWSGGSGKARGWEAAAGGRSSPGRLSRRRIMSMSPKHTTPFSVSDILSPLEESYKKVGME
GGGLGAPLAAYRQGQAAPPAAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGN
LGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVS
KNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQ
NHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGAGCPQQQQAQQQSPRRVAVPVLVKDGKPC
QAGAPAPGAASLQGHAQQQAQQQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDL
AHHAASPAALQGQVSSLSHLNSSGSDYGTMSCSTLLYGRTW
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgtggtccggaggcagtgggaaggcgcggggctgggaggccgcggcgggagggaggagc
agccccggcaggctcagccgccgccgaatcatgtcgatgagtccaaagcacacgactccg
ttctcagtgtctgacatcttgagtcccctggaggaaagctacaagaaagtgggcatggag
ggcggcggcctgggggctccgctggcggcgtacaggcagggccaggcggcaccgccggcc
gcggccatgcagcagcacgccgtggggcaccacggcgcagtcaccgccgcctaccacatg
acggcggcgggggtgccccagctctcgcactccgccgtggggggctactgcaacggcaac
ctgggcaacatgagcgagctgccgccgtaccaggacaccatgaggaacagcgcctctggc
cccggatggtacggcgccaacccagacccgcgcttccccgccatctcccgcttcatgggc
ccggcgagcggcatgaacatgagcggcatgggcggcctgggctcgctgggggacgtgagc
aagaacatggccccgctgccaagcgcgccgcgcaggaagcgccgagtgctcttctcgcag
gcgcaggtgtacgagctggagcgacgcttcaagcaacagaagtacctgtcggcgccggag
cgcgagcacctggccagcatgatccacctgacccccacgcaggtcaagatctggttccag
aaccaccgctacaaaatgaagcgccaggctaaggacaaggcggcgcagcagcaactgcag
caggacagcggcggcggcgggggcggcgggggcgccgggtgcccgcagcagcaacaggct
cagcagcagtcgccgcgacgtgtggcggtgccggtcctggtgaaagacggcaaaccgtgc
caggcgggtgcccccgcgccgggcgccgccagcctacaaggccacgcgcagcagcaggcg
cagcagcaggcgcaggcagcgcaggcggcggcagcggccatctccgtgggcagcggtggc
gctggccttggcgcacacccgggccaccagccaggcagtgcaggccagtctccggacctg
gcgcaccacgccgccagccccgcggcgctgcagggccaggtatccagcctgtcccacctg
aactcctcgggctcggactacggcaccatgtcctgctccaccttgctatatggtcggacc
tggtga

DBGET integrated database retrieval system