KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664278
Entry
104664278         CDS       T03989                                 

Gene name
JUN
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04024  cAMP signaling pathway
rro04137  Mitophagy - animal
rro04210  Apoptosis
rro04310  Wnt signaling pathway
rro04380  Osteoclast differentiation
rro04510  Focal adhesion
rro04530  Tight junction
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04657  IL-17 signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04668  TNF signaling pathway
rro04722  Neurotrophin signaling pathway
rro04912  GnRH signaling pathway
rro04915  Estrogen signaling pathway
rro04921  Oxytocin signaling pathway
rro04926  Relaxin signaling pathway
rro04932  Non-alcoholic fatty liver disease
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro05030  Cocaine addiction
rro05031  Amphetamine addiction
rro05132  Salmonella infection
rro05133  Pertussis
rro05135  Yersinia infection
rro05140  Leishmaniasis
rro05142  Chagas disease
rro05161  Hepatitis B
rro05162  Measles
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05224  Breast cancer
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05321  Inflammatory bowel disease
rro05323  Rheumatoid arthritis
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104664278 (JUN)
   04012 ErbB signaling pathway
    104664278 (JUN)
   04310 Wnt signaling pathway
    104664278 (JUN)
   04668 TNF signaling pathway
    104664278 (JUN)
   04024 cAMP signaling pathway
    104664278 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    104664278 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    104664278 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104664278 (JUN)
   04530 Tight junction
    104664278 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104664278 (JUN)
   04621 NOD-like receptor signaling pathway
    104664278 (JUN)
   04625 C-type lectin receptor signaling pathway
    104664278 (JUN)
   04660 T cell receptor signaling pathway
    104664278 (JUN)
   04658 Th1 and Th2 cell differentiation
    104664278 (JUN)
   04659 Th17 cell differentiation
    104664278 (JUN)
   04657 IL-17 signaling pathway
    104664278 (JUN)
   04662 B cell receptor signaling pathway
    104664278 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    104664278 (JUN)
   04915 Estrogen signaling pathway
    104664278 (JUN)
   04921 Oxytocin signaling pathway
    104664278 (JUN)
   04926 Relaxin signaling pathway
    104664278 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104664278 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104664278 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104664278 (JUN)
   05203 Viral carcinogenesis
    104664278 (JUN)
   05231 Choline metabolism in cancer
    104664278 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104664278 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104664278 (JUN)
   05211 Renal cell carcinoma
    104664278 (JUN)
   05224 Breast cancer
    104664278 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    104664278 (JUN)
   05321 Inflammatory bowel disease
    104664278 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    104664278 (JUN)
   05031 Amphetamine addiction
    104664278 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104664278 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104664278 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104664278 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104664278 (JUN)
   05135 Yersinia infection
    104664278 (JUN)
   05133 Pertussis
    104664278 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104664278 (JUN)
   05170 Human immunodeficiency virus 1 infection
    104664278 (JUN)
   05161 Hepatitis B
    104664278 (JUN)
   05171 Coronavirus disease - COVID-19
    104664278 (JUN)
   05162 Measles
    104664278 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104664278 (JUN)
   05169 Epstein-Barr virus infection
    104664278 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    104664278 (JUN)
   05142 Chagas disease
    104664278 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104664278 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104664278 (JUN)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    104664278 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha TFIIA FlaC_arch NBP1 Jnk-SapK_ap_N DUF3450
Other DBs
NCBI-GeneID: 104664278
NCBI-ProteinID: XP_010364046
LinkDB
Position
12
AA seq 334 aa
MTAKMETTFYDDALNASFLPSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGSGSGGFSASMHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPG
ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctatgacgatgccctcaacgcctcgttcctcccg
tccgagagcggagcttatggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccagtggggagcctgaagccgcacctccgcgccaagaactcggacctc
ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata
atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc
aagaacgtgacagacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtcagcggcgcagccggtcagcggggcg
ggcatggtggctccagcggtagcctcggtggcagggggcagcggcagcggaggcttcagc
gccagcatgcacagcgagccgcccgtctacgccaacctcagcaacttcaacccaggcgcg
ctgagcagtggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcaa
ccccagcagcagcagcagccgccgcagccgccgcaccacctgccccagcagatgcccgtg
cagcacccgcggctgcaagccctgaaggaggagcctcagacagtgcccgagatgcctggg
gagacgccgcccctgtcccccattgacatggagtcccaggagcggatcaaggcggagagg
aagcgcatgaggaaccgcattgctgcctccaagtgccgaaaaagaaagctggagagaatc
gcccggctggaggaaaaagtgaaaaccttgaaagctcagaactcggagctggcgtccacg
gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac
agtgggtgccaactcatgctaacgcagcagttgcaaacattttga

DBGET integrated database retrieval system