KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664292
Entry
104664292         CDS       T03989                                 

Gene name
PRKAA2
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04068  FoxO signaling pathway
rro04140  Autophagy - animal
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04371  Apelin signaling pathway
rro04530  Tight junction
rro04710  Circadian rhythm
rro04714  Thermogenesis
rro04910  Insulin signaling pathway
rro04920  Adipocytokine signaling pathway
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro05410  Hypertrophic cardiomyopathy
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104664292 (PRKAA2)
   04068 FoxO signaling pathway
    104664292 (PRKAA2)
   04151 PI3K-Akt signaling pathway
    104664292 (PRKAA2)
   04152 AMPK signaling pathway
    104664292 (PRKAA2)
   04150 mTOR signaling pathway
    104664292 (PRKAA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104664292 (PRKAA2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104664292 (PRKAA2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104664292 (PRKAA2)
   04922 Glucagon signaling pathway
    104664292 (PRKAA2)
   04920 Adipocytokine signaling pathway
    104664292 (PRKAA2)
   04921 Oxytocin signaling pathway
    104664292 (PRKAA2)
  09149 Aging
   04211 Longevity regulating pathway
    104664292 (PRKAA2)
   04213 Longevity regulating pathway - multiple species
    104664292 (PRKAA2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    104664292 (PRKAA2)
   04714 Thermogenesis
    104664292 (PRKAA2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104664292 (PRKAA2)
   05410 Hypertrophic cardiomyopathy
    104664292 (PRKAA2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104664292 (PRKAA2)
   04931 Insulin resistance
    104664292 (PRKAA2)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     104664292 (PRKAA2)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   104664292 (PRKAA2)
Membrane trafficking [BR:rro04131]
 Autophagy
  Other autophagy associated proteins
   Others
    104664292 (PRKAA2)
Mitochondrial biogenesis [BR:rro03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    104664292 (PRKAA2)
  Mitophagy factors
   Other mitophagy factors
    104664292 (PRKAA2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 104664292
NCBI-ProteinID: XP_030769353
LinkDB
Position
12
AA seq 552 aa
MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLF
QQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
VATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKF
ECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIP
PGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVY
RAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQR
SGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFF
EMCASLITTLAR
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggctgagaagcagaagcacgacgggcgggtgaaaatcggacactacgtgctgggcgac
acgctgggcgtcggcaccttcggcaaagtgaagattggagaacatcaattaacaggccat
aaagtggcagttaaaatcttaaatagacagaagattcgcagtttagatgttgttggaaaa
ataaaacgagaaattcaaaatctaaaactctttcgtcatcctcatattatcaaactatac
caggtgatcagcactccaacagatttttttatggtaatggaatatgtgtctggaggtgaa
ttatttgactacatctgtaagcatggacgggttgaagagatggaagccaggcggctcttt
caacagattctgtctgctgtggattactgtcataggcatatggttgttcatcgagacctg
aaaccagagaatgtcctgttggacgcacacatgaatgccaagatagctgattttggatta
tctaatatgatgtcagatggtgagtttctgagaactagttgcggatctccaaattatgca
gcacctgaagtcatctcaggcagattgtatgcaggtcctgaagttgacatatggagctgt
ggtgttatcttgtatgctcttctttgtggcaccctcccatttgatgatgagcatgtacct
acattatttaagaagatccgaggcggtgtcttttatatcccagaatatctcaatcgttct
gtcgccactctcctgatgcatatgctgcaggttgatccactaaaacgagcaactatcaaa
gacataagagagcatgaatggtttaaacaagatttgcccagttacttatttcctgaagac
ccttcctatgatgctaacgtcattgatgatgaggctgtgaaagaagtgtgtgaaaaattt
gaatgtacagaatcagaagtaatgaacagtttatatagtggtgaccctcaagaccagctt
gcagtggcttatcatcttatcattgacaatcggagaataatgaaccaagccagtgagttc
tacctcgcctctagtcctccgtctggttcttttatggatgatagtgccatgcatattccc
ccaggcctgaaacctcatccagaaaggatgccacctcttatagcagacagccccaaagca
agatgtccgttggatgcactgaatacgactaagcccaaatctttagccgtgaaaaaagcc
aagtggcatcttggaatccgaagtcagagcaaaccatatgacattatggctgaagtttac
cgagctatgaagcagctggattttgaatggaaggtagtgaatgcataccatcttcgtgta
agaagaaaaaatccagtgactggcaattacgtgaaaatgagcttacaactttacctggtt
gataacaggagctatcttttggactttaaaagcattgatgacgaagtagtggagcagagg
tctggttcctcaacacctcagcgttcctgttctgctgctggcttacacagaccaagatca
agttttgattccacaactgcagagagccattcactttctggctctctcactggctctttg
accggaagcacattgtcttcagtttcacctcgcctgggcagtcacaccatggattttttt
gaaatgtgtgccagtctgattactactttagcccgttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104676941
Entry
104676941         CDS       T03989                                 

Gene name
PRKAA1
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-1 isoform X1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04068  FoxO signaling pathway
rro04140  Autophagy - animal
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04371  Apelin signaling pathway
rro04530  Tight junction
rro04710  Circadian rhythm
rro04714  Thermogenesis
rro04910  Insulin signaling pathway
rro04920  Adipocytokine signaling pathway
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro05410  Hypertrophic cardiomyopathy
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104676941 (PRKAA1)
   04068 FoxO signaling pathway
    104676941 (PRKAA1)
   04151 PI3K-Akt signaling pathway
    104676941 (PRKAA1)
   04152 AMPK signaling pathway
    104676941 (PRKAA1)
   04150 mTOR signaling pathway
    104676941 (PRKAA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104676941 (PRKAA1)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104676941 (PRKAA1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104676941 (PRKAA1)
   04922 Glucagon signaling pathway
    104676941 (PRKAA1)
   04920 Adipocytokine signaling pathway
    104676941 (PRKAA1)
   04921 Oxytocin signaling pathway
    104676941 (PRKAA1)
  09149 Aging
   04211 Longevity regulating pathway
    104676941 (PRKAA1)
   04213 Longevity regulating pathway - multiple species
    104676941 (PRKAA1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    104676941 (PRKAA1)
   04714 Thermogenesis
    104676941 (PRKAA1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104676941 (PRKAA1)
   05410 Hypertrophic cardiomyopathy
    104676941 (PRKAA1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104676941 (PRKAA1)
   04931 Insulin resistance
    104676941 (PRKAA1)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     104676941 (PRKAA1)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   104676941 (PRKAA1)
Membrane trafficking [BR:rro04131]
 Autophagy
  Other autophagy associated proteins
   Others
    104676941 (PRKAA1)
Mitochondrial biogenesis [BR:rro03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    104676941 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    104676941 (PRKAA1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 104676941
NCBI-ProteinID: XP_030782646
LinkDB
Position
3
AA seq 559 aa
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
DEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FLDDHHLSRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDE
ITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPG
SHTIEFFEMCANLIKILAQ
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgcgcagactcagttcctggagaaagatggcgacagccgagaagcagaaacacgacggg
cgggtgaagatcggccactacatcctgggtgacacgctgggggtcggcaccttcggcaaa
gtgaaggttggcaaacatgaattgactgggcataaagttgctgtgaagatactcaatcga
cagaagattcggagccttgatgtggtaggaaaaatccgcagagaaattcagaacctcaag
cttttcaggcatcctcatataattaaactgtaccaggtcatcagtacaccatctgatatt
ttcatggtgatggaatatgtctcaggaggagagctatttgattatatctgtaagaatgga
aggctggatgaaaaagaaagtcgacgtctgttccaacagatcctttctggtgtggattat
tgtcacaggcatatggtagtccatagagatttgaaacctgaaaatgtcctgcttgatgca
cacatgaatgcaaagatagccgattttggtctttcaaacatgatgtcagatggtgaattt
ttaagaacaagttgtggctcacccaactatgctgcaccagaagtaatttcaggaagattg
tatgcaggcccagaggtagatatatggagcagtggggttattctctatgctttattatgt
ggaacccttccatttgatgatgaccatgtgccaactctttttaagaagatatgtgatggg
atcttctatacccctcaatatttaaatccttctgtgattagccttttgaaacatatgctg
caggtggatcccatgaagagggccacaatcaaagatatcagggaacatgaatggtttaaa
caggaccttccgaagtatctctttcctgaggatccatcatatagttcaaccatgattgac
gatgaagccttaaaagaagtatgtgaaaagtttgagtgttcagaagaggaagttctcagc
tgtctttataacagaaatcaccaggatcctttggcagttgcataccatctcataatagat
aacaggagaataatgaatgaagccaaagatttctatttggcgacaagcccacctgattct
tttcttgatgatcatcacctgtctcggccccatcctgaaagagtaccattcttggttgct
gaaacaccaagggcacgccatacccttgatgaattaaatccacagaaatccaaacaccaa
ggtgtaaggaaagcaaaatggcatttaggaattagaagtcaaagtcgaccaaatgatatt
atggcagaagtatgtagagcaattaaacaattggattatgaatggaaggttgtaaaccca
tattatttgcgtgtacgaaggaagaatcctgtgacaagcacttactccaaaatgagtcta
cagttataccaagtggatagtagaacttatctactggatttccgtagtattgatgatgaa
attacagaagccaaatcagggactgctactccacagagatcgggatcagttagcaactat
cgatcttgccaaaggagtgattcagatgctgaggctcaaggaaaatcctcagaagtttct
cttacctcatctgtgacctcacttgactcttctcctgttgacctaactccaagacctgga
agtcacacaatagaattttttgagatgtgtgcaaatctaattaaaattcttgcacaataa

DBGET integrated database retrieval system