KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664377Help
Entry
104664377         CDS       T03989                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00590  Arachidonic acid metabolism
rro01100  Metabolic pathways
rro04064  NF-kappa B signaling pathway
rro04370  VEGF signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04657  IL-17 signaling pathway
rro04668  TNF signaling pathway
rro04723  Retrograde endocannabinoid signaling
rro04726  Serotonergic synapse
rro04913  Ovarian steroidogenesis
rro04921  Oxytocin signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro05140  Leishmaniasis
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05200  Pathways in cancer
rro05204  Chemical carcinogenesis
rro05206  MicroRNAs in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    104664377 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    104664377 (PTGS2)
   04064 NF-kappa B signaling pathway
    104664377 (PTGS2)
   04668 TNF signaling pathway
    104664377 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104664377 (PTGS2)
   04657 IL-17 signaling pathway
    104664377 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    104664377 (PTGS2)
   04913 Ovarian steroidogenesis
    104664377 (PTGS2)
   04921 Oxytocin signaling pathway
    104664377 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    104664377 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    104664377 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    104664377 (PTGS2)
   05206 MicroRNAs in cancer
    104664377 (PTGS2)
   05204 Chemical carcinogenesis
    104664377 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    104664377 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    104664377 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104664377 (PTGS2)
   05165 Human papillomavirus infection
    104664377 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    104664377 (PTGS2)
Enzymes [BR:rro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     104664377 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 104664377
NCBI-ProteinID: XP_010364162
UniProt: A0A2K6QXQ8
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MLARAVLLCAVLALGHAANPCCSYPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGFWNIVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNVDY
GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHIYGETLDRQHKLRLFKDGKMKY
QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGIAQFVESFTKQIAGRV
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL
YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV
GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSRLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgccgtgctgctgtgcgcagtcctggcgctcggccacgcagcaaatcct
tgctgttcctacccatgtcaaaaccgaggtgtatgtatgagtgtgggatttgaccaatat
aagtgcgattgtacccggacaggattctatggtgaaaactgctcaacaccggaatttctg
acaagaataaaattatttctgaaacccactccaaacacagtgcactacatacttacccac
ttcaagggattttggaacattgtgaataacattcccttccttcgaaatgcaattatgagt
tatgtgttgacatccagatcacatttgattgacagtccaccaacttacaatgttgactat
ggctacaaaagctgggaagccttctctaacctctcctattataccagagcccttcctcct
gtgcctgatgactgcccgactcccttgggtgtgaaaggtaagaagcagcttcctgattca
aatgagattgtggaaaaatttcttctaagaagaaagttcatccctgatccccagggcaca
aacatgatgttcgcattctttgcccagcacttcacgcatcagtttttcaagacagatcat
aagcgagggccagctttcaccaaagggctgggccatggggtggacttaaatcatatttat
ggtgaaactctggatagacagcacaaactgcgccttttcaaggatggaaaaatgaaatat
cagataattgatggagagatgtatcctcccacagtcaaagatactcaggcagagatgatc
taccctcctcaagtccctgagcatctgcggtttgctgtggggcaggaggtctttggtctg
gtgcctggtctgatgatgtatgccacaatctggctgcgggaacacaacagagtgtgcgat
gtgcttaaacaggagcatccggaatggggtgatgagcagttgttccagacaagcaggcta
atactgataggagagactattaagattgtgattgaagattatgtacagcacttgagtggc
tatcacttcaaactgaaatttgacccagaactacttttcaacaaacaattccagtaccaa
aatcgtattgctgctgagtttaataccctctatcactggcatccccttctgcctgacacc
tttcaaattcatgaccagaaatacaactatcaacagtttatctacaacaactctatatta
ctggaacatggaattgcccagtttgttgaatcattcaccaagcaaattgctggcagggtt
gctggtggtaggaatgttccacctgcagtacaaaaagtatcacaggcttccattgaccag
agcaggcagatgaaataccagtcttttaatgagtaccgcaaacgctttatgctgaagccc
tatgaatcatttgaagaacttacaggagaaaaggaaatgtctgcagagttggaagcactc
tacggtgacatcgatgctgtggagctgtatcctgcccttctggtagaaaagcctcgtcca
gatgccatctttggtgagaccatggtagaagttggagcaccgttctccttgaaaggactt
atgggtaatgttatatgttctcctgcctactggaagccaagtacttttggtggagaagtg
ggttttcaaatcatcaacactgcctcaattcagtctctcatctgcaataacgtgaagggc
tgtccctttacttcattcagtgttccagatccagagctcatcaaaacagtcaccatcaat
gcaagttcttcccgctccagactagatgatatcaatcccacagtactactaaaagaacgt
tcgactgaactgtag

DBGET integrated database retrieval system