KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664595
Entry
104664595         CDS       T03989                                 

Gene name
ELK1
Definition
(RefSeq) ETS domain-containing protein Elk-1
  KO
K04375  ETS domain-containing protein Elk-1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04510  Focal adhesion
rro04910  Insulin signaling pathway
rro04912  GnRH signaling pathway
rro04921  Oxytocin signaling pathway
rro05140  Leishmaniasis
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05213  Endometrial cancer
rro05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104664595 (ELK1)
   04012 ErbB signaling pathway
    104664595 (ELK1)
   04014 Ras signaling pathway
    104664595 (ELK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104664595 (ELK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104664595 (ELK1)
   04912 GnRH signaling pathway
    104664595 (ELK1)
   04921 Oxytocin signaling pathway
    104664595 (ELK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104664595 (ELK1)
   05205 Proteoglycans in cancer
    104664595 (ELK1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104664595 (ELK1)
   05213 Endometrial cancer
    104664595 (ELK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104664595 (ELK1)
   05161 Hepatitis B
    104664595 (ELK1)
   05163 Human cytomegalovirus infection
    104664595 (ELK1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    104664595 (ELK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104664595 (ELK1)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    104664595 (ELK1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 104664595
NCBI-ProteinID: XP_030790238
LinkDB
Position
7
AA seq 428 aa
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSAMPTVAPAAVH
ATPGDTASGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVV
LPNAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGL
GRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGH
AASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGTGSGLQAPGPALTPSLLPTH
TLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVV
LSPGPQKP
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggacccatctgtgacgctgtggcagtttctgctgcagctgctgagagagcaaggcaat
ggccacatcatctcctggacttcacgggatggtggtgaattcaagctggtggatgcagag
gaggtggcccggctgtgggggctacgcaagaacaagaccaacatgaattacgacaagctc
agccgggccttgcggtactactatgacaagaacatcatccgcaaggtgagcggccagaag
tttgtctacaagtttgtatcctatcctgaggtcgcagggtgctccactgaggactgcccg
ccccagccagaggtgtctgttacctccgccatgccaactgtggcccctgctgctgtacat
gccaccccaggggacactgcctctggaaagccaggcacacccaagggtgcaggaatggca
ggcccgggtggtttggcacgcagcagccggaacgagtacatgcgctcgggcctctattcc
accttcaccatccagtctctgcagccacagccaccccctcatcctcggcctgctgtggtg
ctccccaatgcagctcctgcaggagcagcagcacccccctcggggagcaggagcaccagt
ccaagccccttggaggcctgcctggaggctgaggaggctggcttgcctctgcaggtcatc
ctgaccccgcccgaggccccaaacctgaaatcggaagagctgaatgtggagccaggtttg
ggccgggctttgcccccagaggtgaaagtggaagggcccaaggaagagttggaagttgcc
ggggagagagggtttgtgccggaaactaccaaggccgagccagaagtccctccacaggag
ggcgtgccagcccggctgcccgcggttgttatggacaccgcagggcaggcaggcggccac
gcggcttccagccctgagatctcccagccacagaagggccggaagccccgggacctagag
cttccactcagcccgagcctgctaggtgggccaggacccgaacggaccccaggatcggga
actggctccggcctccaggcacctgggccggcgctaactccgtccctacttcctacgcat
acattgaccccggtgctgctgacacccagctcgctgcctcccagcattcacttctggagc
accctgagtcccattgcgccccgtagcccggccaagctctccttccagtttccgtccagt
ggcagcgcccaggtgcacatcccttccatcagcgtggatggcctctcgacccccgtggtg
ctctccccagggccccagaagccatga

DBGET integrated database retrieval system