KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664621Help
Entry
104664621         CDS       T03989                                 

Gene name
THPO
Definition
(RefSeq) LOW QUALITY PROTEIN: thrombopoietin
  KO
K06854  thrombopoietin
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  Jak-STAT signaling pathway
rro04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    104664621 (THPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104664621 (THPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104664621 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104664621 (THPO)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  CSF and other factors
   104664621 (THPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EPO_TPO
Motif
Other DBs
NCBI-GeneID: 104664621
NCBI-ProteinID: XP_010364464
LinkDB All DBs
Position
1
AA seq 493 aa AA seqDB search
MNPPIQVFSRVCVGGGVDPGPGRGSREEKASLPGAFASVWWFPPLIGQKWPRQPCDLLLW
RGFAPPPHVFQPICSPEGCLLCTWVLEPLSTWIDSSSLARLXPTLLCPEVQEPKPPPWPQ
EGFRGEAPNREPRQPDTPARMELTELLLVVMLLLTARLTLSSPAPPACDPRVLSKLLRDS
HVLHSRLSLCPEVNPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARG
QLGPTCLSSLLGQLSGQVRLLLGVLQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKV
RFLLLVGGPTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLQK
RQQGFRAKIPGLLNQTSRSLDQIPGYLNKIHELLNGTRGLFPGPSRRTLGAPDISPGTSD
TGSLPPKLQPGYSPSPTHPPTGQYTLFPLPPTLPSPVVQLHPLLPDPSAPTPTPTSPLLN
TSHTHSQNLSQEG
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaatccccctatccaagtcttctccagggtgtgtgtgggtggaggagtggaccctggt
ccaggcaggggctccagggaagagaaggcgtcacttccgggggccttcgccagtgtctgg
tggttccctcctctgattgggcagaagtggcccaggcagccgtgtgacctgctgctgtgg
aggggctttgccccaccgccacatgtcttccaacccatctgctccccagagggctgcctg
ctgtgcacttgggtcctggagcccttatccacctggatagattcctcatccttggcccgc
ctttgacccaccctactctgcccagaagtgcaagagcccaagccgcctccatggccccag
gaaggattcaggggagaggccccaaacagggagccacgccagccagacaccccggccaga
atggagctgactgaattgctcctcgtggtcatgcttctcctaactgcaaggctaactctg
tccagcccggctcctcctgcctgtgacccccgagtcctcagtaaactgcttcgtgactcc
catgtccttcacagcagactgagcctgtgcccagaggttaaccctttgcccacacctgtc
ctgctgcctgctgtggactttagcttgggagaatggaaaacccagatggaggagaccaag
gcacaggacattctgggagcagtgacccttctgctggagggagtgatggcagcacgggga
caactgggacccacttgcctctcatccctcctggggcagctttctggacaggtccgtctc
ctccttggggtcctgcagagcctccttggaacccagcttcctccacagggcaggactaca
gctcacaaggatcccaatgccatcttcctgagcttccaacacctgctccgaggaaaggtg
cgtttcctgctgcttgtaggagggcccaccctctgcgtcaggcgggccccacccaccaca
gctgtccccagcagaacctctctagtcctcacactgaacgagctcccaaacaggacttct
ggattgttggagacaaacttcactgcctcggccagaactactggctctggacttcagaag
cggcagcagggattcagagccaagattcctggtctgctgaaccaaacctccaggtccctg
gaccaaatccccggatacctgaacaagatacacgaactcttgaatggaactcgtggactc
tttcctggaccctcacgcaggaccctaggagccccggacatttccccaggaacatcagac
acaggctccctgccacccaaactccagcctggatattctccttccccaacccatccccct
actggacagtacacactcttccctcttccacccaccttgccctcccctgtggtccagctc
caccccctgcttcctgacccttctgctccaacacccacccctaccagccctcttctaaac
acatcccacacccactcccagaatctgtctcaggaagggtaa

DBGET integrated database retrieval system