KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664637
Entry
104664637         CDS       T03989                                 

Gene name
HTR3E
Definition
(RefSeq) LOW QUALITY PROTEIN: 5-hydroxytryptamine receptor 3E
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04726  Serotonergic synapse
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    104664637 (HTR3E)
  09157 Sensory system
   04742 Taste transduction
    104664637 (HTR3E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104664637 (HTR3E)
Ion channels [BR:rro04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   104664637 (HTR3E)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 104664637
NCBI-ProteinID: XP_010364501
LinkDB
Position
1
AA seq 463 aa
MEGSWFHRKIFSFYLLLSLLVQGRGVTFTIKYSGFGQHRVDPTALNSVFNRKAFRAVTIS
VPTGVNISFTMSTIPDVDEQLYLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNLW
LPDIFIVELMDVDKTPKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTFS
SFLYTVDSMLLDMEKEVWEITDTSWDILQAHGEWELPGINKATAKMSRGGNLYDQIVFYV
AIRRRPSLYVINLLMPSGFLAAIDALSFYXPVKSGKHVPFKIMLLLGYNVFLLMMNDLLP
TSGTPLIGVYFTLCLSLMVDSLLETVFITHLLHVATTQPAPLPLWLHSLLLHNTSPGRCC
PTAPQRGNKGLGLTPTHLPGEGICLSVSVKEPEVSAGQMPGPGKAELTGGSEWTRAQWEH
EAQKQHSVELWVQFSHVMDALLFRLYLLFMASSVLTVICLWNT
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggaaggaagctggttccacaggaaaatattttccttctacctccttctcagtcttctg
gttcaaggaaggggcgttactttcaccatcaaatactcagggtttggccagcacagggtg
gatcccactgctctgaattcagtgtttaatagaaaggccttccgagcagtcaccatcagt
gtccccaccggagtcaacatctccttcacgatgtctaccatcccagatgtagatgaacag
ctgtacctcttgtcatccttcctgtggctggaaatggtttgggataacccatttatcagc
tggaacccagaggagtgtgagggcatcacgaagatgagtatggcagccaagaacctgtgg
ctcccagacattttcatcgttgaactcatggatgtggataagaccccaaaaggccttaca
gcatatgtaagtaatgaaggtcgcatcaggtataagaaacccatgaaggtggacagtatc
tgtaacctggacattttctacttccccttcgaccagcagaactgcacactcaccttcagc
tcattcctctatacagtggacagcatgttgctggacatggagaaagaagtgtgggaaata
acagacacatcctgggacatccttcaggcccatggagaatgggagctcccgggcatcaac
aaggccaccgcaaagatgtccaggggaggcaacctgtatgatcagattgtgttctatgtg
gccatcaggcgcaggcccagcctctatgtcataaaccttctcatgcccagtggctttctg
gctgccatcgatgccctcagcttctacntgccagtgaaaagtgggaaacatgtcccattc
aagataatgctcctgctgggctacaacgtcttcctgctcatgatgaatgacttgctcccc
accagtggcacccccctcatcggtgtctacttcaccctgtgcctctccctgatggtggac
agcctgctggagaccgtcttcatcacccacctgctgcacgtggccacaacccagcccgca
cccctgcctctgtggctccactccctgctgctccacaacaccagcccagggagatgctgt
cccactgcgccccagaggggaaataagggcctgggtctcacccccacccacctgcctggt
gagggaatctgtctttctgtaagtgtgaaggagccagaggtatcagcagggcagatgcca
ggccctgggaaggcagagctgacagggggctcagaatggacaagggcccagtgggaacat
gaggcccagaagcagcactcggtggagctgtgggtgcagttcagccacgtgatggatgcc
ctgctcttccgcctctacctgctcttcatggcctcctccgtcctcactgtcatatgcctc
tggaacacctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664638
Entry
104664638         CDS       T03989                                 

Gene name
HTR3D
Definition
(RefSeq) 5-hydroxytryptamine receptor 3D isoform X1
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04726  Serotonergic synapse
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    104664638 (HTR3D)
  09157 Sensory system
   04742 Taste transduction
    104664638 (HTR3D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104664638 (HTR3D)
Ion channels [BR:rro04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   104664638 (HTR3D)
SSDB
Motif
Pfam: Neur_chan_memb
Other DBs
NCBI-GeneID: 104664638
NCBI-ProteinID: XP_030795224
LinkDB
Position
1
AA seq 406 aa
MERGWFHGKGFLLSFILHLLLQDSHLQLVTSFLWVNMWNPDECRGIKKSGMATENLWLSD
VFIEQSVNQTPAGLMASMSIVKVTSNTISQWEWSASVNWTPSISPSMNRAARSPSALSPT
QVTWAWRRTSRSFQIHHRTSFRARREWVLLGIHQRAIKVTMATNQYEQAIFYVVIRCRRR
PSPYVVNFLVPIDVLSFHLPLESRNYAPLKTTVLLGYSVFLLMMNDLLPAIGTSSHASSV
CPHPPREQKRGVYFALCLSLMVDSLLETIFITHLLHVATTHPPPLPRWLYFLLLHCTSPG
RCCPTAPQKGNKGLGLTPTHLPGEGICLSVSVKEPEVSAGQMPGPGEAELTGGSEWTRSQ
WEHEAQKQHSVELWVQFSHVMDALLFRLYLLFMASSVLIVICLWNT
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggaaagaggctggttccatgggaaaggattcctcctcagcttcatcctccacctgctg
ctgcaggattcacatcttcaactggtgacatcattcctgtgggtaaatatgtggaaccca
gatgaatgcagaggcatcaagaagtctggcatggcaactgagaacctatggctttcagat
gtcttcatcgagcagtctgtgaatcagacacctgcaggtctcatggctagtatgtcaata
gtgaaggtcacatcaaatacaataagccaatgggagtggtcagcatctgtaaactggaca
ccttctatttccccttccatgaacagagctgcacgctctccttcagctctttcacctaca
caggttacctgggcatggagaaggacgtccaggagctttcagatacatcacagaacctca
ttcagagcaaggagggagtgggtactgctgggtatccaccaaagagcaataaaagtgacc
atggccactaaccagtatgaacaagccatcttctatgtggtcatcagatgcaggcgcagg
cccagcccctacgtggtaaactttctggtgcccatcgacgtcctcagtttccacctgcca
ctggaaagtaggaactatgccccactcaagacgactgttctgctgggctacagcgtcttc
ttgctcatgatgaatgacttgctcccagccattggcacttcatcacacgcttcatcagta
tgtcctcatccaccaagagagcaaaagcgaggtgtctacttcgccctgtgcctctccctg
atggtggacagcctgctggagaccatcttcatcacccacctgctgcacgtggccaccacc
catcccccacccctgcctcggtggctctacttcctgctgctccactgcaccagcccaggg
agatgctgtcccactgcgccccagaagggaaataagggcctgggtctcacccccacccac
ctgcctggtgagggaatctgtctttctgtaagtgtgaaggagccagaagtatcagcaggg
cagatgccaggccctggggaggcagagctgacagggggctcagaatggactaggtcccag
tgggaacatgaggcccagaagcagcactcggtggagctgtgggtgcagttcagccacgtg
atggatgccctgctcttccgcctctacctgctcttcatggcctcctccgtcctcattgtc
atatgcctctggaacacctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664659
Entry
104664659         CDS       T03989                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: 5-hydroxytryptamine receptor 3C-like
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04726  Serotonergic synapse
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    104664659
  09157 Sensory system
   04742 Taste transduction
    104664659
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104664659
Ion channels [BR:rro04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   104664659
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 104664659
NCBI-ProteinID: XP_030793655
LinkDB
Position
1
AA seq 385 aa
MSTPLTESGHLTGGGFKTSNQSGPSSFKLKDLGDPDESPEKSAGEEDGGRWPAGLGVFSS
ASLSAFCFKAIFNQKAFCPVINSSLPAHVNISFTLSAILAVIWENPLSSWDPEEYGDINK
LTVTAENPWFPDIFIMESWEIGTSSDTVQTQWKWELLGINKATLKIPVSSSLFDQIMLSV
AIRCRPSLCVINFLVHSGFLVAIDALSFYLPAESANHALFKATLRLGCSVFLRMVNILLP
ASVTHHHRGTCGLASSLLLIPTPGVYFXLSLMVGSLLETVFITHLLHVATTQPPSMPRWL
HSLLLHCTSPGRCCPTAPQKGNKSLGLTPTHLPGTKESGELAGKELRPRETELDGGSGWT
KAQLVELWVQFSHAIDTLLFCLWNT
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgtccacgccactcacagagagtggtcacctgacaggaggaggattcaaaaccagcaac
cagagtggtcccagctccttcaagctcaaggatctaggggatcctgatgagtctccagag
aagagcgcaggagaggaggatggagggaggtggcctgctggcctgggggtgttctcttct
gcctcactgtcagccttctgcttcaaggccatatttaaccagaaggccttctgtccagtc
atcaactccagcctccccgctcatgtcaacatctccttcaccctgtctgccatactggca
gtgatctgggaaaacccactcagcagctgggacccagaagaatatggtgatatcaataaa
ctcactgtgacagctgagaacccatggttcccagacatcttcatcatggaatcgtgggaa
ataggtacttcaagtgacactgtccaaacacagtggaagtgggagctcctgggcatcaac
aaggccaccctgaagatacctgtgagttccagtctttttgaccaaatcatgttgtctgtg
gccatccggtgcaggcccagcctctgtgtgataaactttctggtgcacagtggctttctg
gttgccatcgatgccctcagcttctacctaccagcagaaagtgcgaatcatgccctattc
aaggccacccttcggctgggctgcagcgtcttcctgcgcatggtgaatatactactcccc
gctagtgtcacccatcatcatcgtggtacctgtggacttgcctcaagcctgcttcttatc
cccaccccaggtgtctacttcngcctgtccctgatggtgggcagcctgctggagactgtc
ttcatcacccacctactgcatgtggccaccacccagcccccatccatgcctcggtggctc
cactccctgctactccactgcaccagcccagggagatgctgtcccactgcgccccagaag
ggaaataagagcttgggtctcacccccacccacctgcctggcacaaaggagtcgggggag
ttagcagggaaggagttgagacccagagagaccgagctagatgggggctcaggatggaca
aaggcccagctagtggagctgtgggtgcagttcagccacgcgatagacaccctgctcttc
tgcctctggaacacctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664661
Entry
104664661         CDS       T03989                                 

Gene name
HTR3C
Definition
(RefSeq) LOW QUALITY PROTEIN: 5-hydroxytryptamine receptor 3C
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04726  Serotonergic synapse
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    104664661 (HTR3C)
  09157 Sensory system
   04742 Taste transduction
    104664661 (HTR3C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104664661 (HTR3C)
Ion channels [BR:rro04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   104664661 (HTR3C)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 104664661
NCBI-ProteinID: XP_010364540
LinkDB
Position
1
AA seq 470 aa
MEGGWPASGGVLLCLTVSLLLQGKGDAFTINCSGFDQHGVDPAAFQVVFDRKAFCPFTNY
SIPTRVNISFTLSAILRVDAQLQLLTSFLWMDLVWDNPFISXNPKECVGINKLTVLAENL
WLPDIFIVEFMDVSQTPLSLTAYINSEGQIKYDKPMRVTSICNLDIFYFPFDQQNCTFTF
SSFLHTVDGMLLGMDKEVWEITDTSRNVIRTQGEWELLGINKATPKMSMGNNLYDQIMFY
VAIRHKPSLYIINLLVPSSFLIAIDALSFYLPAESKNHAPFKITLLLGCNVFLLMMNDLL
PASGTLLINVYFALSLSLMVVSLLETVFITYLLHVATTQPAPMPLWLHSLLLHYTSSGRC
CPTAPQKGNKGLGLTPTHLPGTKEAGELTGKQLGPRETELDGGSGCTKTQLMEQWVQFSH
AIDTLLFRLYLLGHLIAKTDVPGLRGYFKFPHGYSLLSSPVPGPSRNGGQ
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggaaggagggtggcctgcaagcgggggtgtcctcctctgcctcactgtcagtcttctg
cttcaaggaaaaggcgacgcttttaccatcaattgctctggctttgaccagcatggggtt
gaccctgctgccttccaagtagtgtttgacagaaaggccttctgtccattcaccaactac
agcatccctacccgtgtcaacatctccttcaccctgtctgccatcctgagagtggatgca
cagctccagctgctgacatcattcctgtggatggatttggtgtgggacaatcctttcatt
agttgaaacccaaaagagtgtgttggcatcaataaactcacagtattagctgaaaacctg
tggctcccagacatcttcatcgtggaattcatggatgtgtctcagacgcctttgagtctc
actgcctatatcaacagtgaaggtcaaataaagtacgataagccaatgagggtgaccagc
atctgcaacctagacatcttctacttcccttttgaccaacagaactgtaccttcaccttc
agttctttcctccacacagtggacggcatgctgctgggcatggacaaggaggtgtgggag
atcacagacacgtctcgcaacgtcatccgaacccagggggagtgggagctcttgggcatc
aacaaggccaccccaaagatgtccatgggcaacaacctatatgaccagatcatgttctat
gtggccatcaggcacaagcccagcctctacatcataaacctgctggtgcccagtagcttt
ctgattgccattgatgccctcagcttttacctgccagcagagagcaagaatcatgcccca
ttcaagataacgcttctgctgggctgcaacgtcttcctgctcatgatgaatgacttgctt
cctgccagtggcaccctcctcatcaatgtctacttcgccctgtccctctccctgatggtg
gtcagcctgctagagaccgtcttcattacctacctgctgcacgtggccaccacccagccc
gcacccatgcctctgtggctccactccctgctgctccactacaccagctcagggagatgc
tgtcccactgcgccccagaagggaaataaaggcctgggtctcacccccacccacctgcct
ggcacaaaggaggcgggggagttaacagggaagcagctgggacccagagagaccgagcta
gatgggggctcaggatgcacaaagacccagctaatggagcagtgggtgcagttcagccat
gcgatagacaccctgctcttccgcctctacttgctcggccacctgatagctaaaacagat
gttccagggttgaggggctactttaagttccctcacggctacagcctcctgtcctctcca
gtccctgggccttccagaaatggaggtcagtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669405
Entry
104669405         CDS       T03989                                 

Gene name
HTR3A
Definition
(RefSeq) 5-hydroxytryptamine receptor 3A isoform X1
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04726  Serotonergic synapse
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    104669405 (HTR3A)
  09157 Sensory system
   04742 Taste transduction
    104669405 (HTR3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104669405 (HTR3A)
Ion channels [BR:rro04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   104669405 (HTR3A)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 104669405
NCBI-ProteinID: XP_010370668
LinkDB
Position
15
AA seq 514 aa
MLLWVQQALLALLLPMLLAQGEARRSGGLQGRNTTRPALLRLSDYLLTNYRKGVRPVRDW
RKPTTVSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSI
WVPDILINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTF
TSWLHTIQDINISLWRLPEKVKFDKSVFMNQGEWELLGVLPDFQEFMESSHCYAEMKFYV
VIRRRPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITLLLGYSVFLIIVSDTLP
ATAIGTPLIGKVSPGSRAQSGEKLTPSHLLYVSLASALDCTGVYFVVCMALLVISLAETI
FIVRLVHKQDLQQPVPAWLRHLVLERIAWLLCLREQSTSQKPPATSQATKTDDCSAMRNH
CNHMGGSQDLEKNPRGRCSPPPPPREGSLAVCGLLQELSSIRHFLEKRDEIREVARDWLR
VGSVLDRLLFHIYLLAVLAYSITLVMLWSIWQYA
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgctgctgtgggtccagcaggcactgctcgccttgctcctccccatgctcctggcacag
ggagaagccaggaggagcggtggccttcagggccgaaataccaccagacctgctctgctg
aggctgtcggattaccttctgaccaactacaggaagggcgtgcgccccgtaagggactgg
agaaagccaaccactgtatccattgacgtcattgtctatgctatcctcaacgtggatgag
aagaatcaggtgctgaccacctacatctggtaccggcagtactggactgatgagtttctc
cagtggaaccctgaggactttgacaacatcaccaagttgtccatccccacggacagcatc
tgggtcccagacattctcatcaatgagtttgtggatgtgggaaagtctccaaatatccca
tacgtgtatattcggcatcaaggcgaagttcagaactacaagcccctccaggtggtgact
gcctgtagcctcgacatctacaactttcccttcgatgtccagaactgctcgctgaccttc
accagctggctgcacaccatccaggacatcaacatctctttgtggcgcttgccagaaaag
gtgaaattcgacaagagtgtcttcatgaaccagggagaatgggagttgctgggggtgctg
cccgactttcaggagttcatggaaagcagtcactgctatgcagaaatgaagttctatgtg
gtcatccgccggcggcccctcttctatgtggtcagcctgctgctgcccagcatcttcctc
atggtcatggacatcgtgggcttctacctgccccccaacagtggtgagagggtctccttc
aagatcacactcctcctgggctactcggtcttcctaatcatcgtttctgacacgctgccg
gccactgccatcggcactcctctcattggtaaggtctctcctggcagcagagctcagtct
ggtgagaaactcaccccctcccacctcctgtatgtgtctcttgcctctgccctggactgc
acaggtgtctattttgtggtgtgcatggctctgctggtgataagtttggctgagaccatc
ttcattgtgcggctggtgcacaagcaagacctgcagcagcccgtgcctgcctggctgcgt
cacctggttctagagagaattgcctggctactttgtctgcgggagcagtcgacttcccag
aagcctccagctacctcccaagccaccaagactgatgactgctcagccatgagaaaccac
tgcaaccacatgggaggatcccaggacttggagaagaacccgaggggcagatgtagccct
cccccaccacctcgggagggctcgctggcggtgtgtgggctgctgcaggagttgtcctcc
atccggcacttcctggagaagcgggatgagatccgagaggtggcccgagactggctgcgc
gtgggctccgtgctggacaggctgctgttccacatttacctgctggcggtgctggcctac
agcatcaccctggttatgctctggtccatctggcagtatgcttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669407
Entry
104669407         CDS       T03989                                 

Gene name
HTR3B
Definition
(RefSeq) 5-hydroxytryptamine receptor 3B isoform X1
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04726  Serotonergic synapse
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    104669407 (HTR3B)
  09157 Sensory system
   04742 Taste transduction
    104669407 (HTR3B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104669407 (HTR3B)
Ion channels [BR:rro04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   104669407 (HTR3B)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 104669407
NCBI-ProteinID: XP_010370671
UniProt: A0A2K6PCP1
LinkDB
Position
15
AA seq 441 aa
MLASVMAPLWACILVAAGILATDTHHPRDSAVYHLSKQLLQKYHKEVRPVYNWTKATTVY
LDLFVHAILDVDAENQILKTSVWYWEVWNDEFLSWNSSLFDEIREISLPLSAIWAPDIII
NEFVDIERSPDLPYVYVNSSGTIENSKPIQVVSACSLDTYAFPFDVQNCSLTFKSILHTV
EDVDLAFLRSPEDIKHDKKVFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPL
VYVVSLLIPNIFLMLVDLGSFYVPPNCQARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTP
LIGHFFSICMAFLVLSLAKSIVLVKFLHDERRGGQEQPFVCLRGDTSADRPRVEPRAQRA
VVTESLFYGEHPAQPGTLKEICSQLQCINNYLQTQDQTDQQEAEWLVLLSRFDRLLFRSY
LFMLGLYTITLCSLWALWGGV
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgttggcaagcgtgatggctcccctgtgggcctgcatcctggtggctgcaggaattcta
gccacagatacacatcatccccgggattctgctgtgtatcatctcagcaagcaactatta
cagaaatatcataaagaagtgaggccagtttacaactggaccaaggccaccacagtctac
ctggacctgtttgtccatgctatattggatgtggatgcagagaatcaaatattaaagaca
agtgtatggtactgggaggtctggaatgatgaatttttatcctggaactccagcttgttt
gatgagattagagagatctccctacctctaagtgctatctgggccccagatatcatcatc
aatgagtttgtggacattgaaagatcccctgaccttccctatgtttatgtgaactcatct
gggaccattgagaactctaagcccatccaggtggtctccgcatgcagtttagacacatat
gcttttccatttgatgtccagaattgcagcctaaccttcaagagcattctgcatacagtg
gaagacgtagacctggcctttctgaggagcccagaagatattaagcatgacaaaaaggtg
tttttgaatgacagtgagtgggaacttctatctgtgtcctccacatacagcatcctgcag
agcagcgctggaggatttgcacagattcagtttaatgtggtgatgcgcagacaccccctg
gtctacgtcgtgagtctgctgattcctaacatctttctcatgctggtggacctggggagc
ttctatgtgccacccaactgccaagccaggattgtgttcaagaccagtgtgctggtgggc
tacaccgtcttcagggtcaacatgtccaaccaggtgccacggagtgtagggagcacccct
ctgattgggcacttcttcagcatctgcatggccttcttggttcttagcttagctaagtcc
atcgtgttggtcaaattcctccacgatgagcggcgtggtggacaggagcagcccttcgtg
tgccttcgaggggacaccagcgctgacaggcctagagtggaacccagggcccagcgtgct
gtggtaacagagtccttgttctatggagagcacccggcccagccaggaaccctgaaggaa
atctgttcgcagcttcagtgtatcaacaactatctccaaactcaggaccagacagaccaa
caggaggcagagtggctggtcctcctgtcccgctttgatcgactgctcttccgaagctac
cttttcatgctggggctctacaccattactctgtgctccctctgggcactgtggggcggc
gtgtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 115895917
Entry
115895917         CDS       T03989                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: 5-hydroxytryptamine receptor 3B-like
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04726  Serotonergic synapse
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    115895917
  09157 Sensory system
   04742 Taste transduction
    115895917
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    115895917
Ion channels [BR:rro04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   115895917
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 115895917
NCBI-ProteinID: XP_030782318
LinkDB
Position
Unknown
AA seq 231 aa
DAENQILKTSVWYWEVWNDEFLSWNSSLFDEIREISLPLSAIWAPDIIINEFVDIERSPD
LPYVYVNSSGTIENSKPIQVVSACSLDTYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSP
EDIKHDKKXFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPNI
FLMLVDLGSFYVPPNCQARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTPLI
NT seq 694 nt   +upstreamnt  +downstreamnt
gatgcagagaatcaaatattaaagacaagtgtatggtactgggaggtctggaatgatgaa
tttttatcctggaactccagcttgtttgatgagattagagagatctccctacctctaagt
gctatctgggccccagatatcatcatcaatgagtttgtggacattgaaagatcccctgac
cttccctatgtttatgtgaactcatctgggaccattgagaactctaagcccatccaggtg
gtctccgcatgcagtttagacacatatgcttttccatttgatgtccagaattgcagccta
accttcaagagcattctgcatacagtggaagacgtagacctggcctttctgaggagccca
gaagatattaagcatgacaaaaagngttttttgaatgacagtgagtgggaacttctatct
gtgtcctccacatacagcatcctgcagagcagcgctggaggatttgcacagattcagttt
aatgtggtgatgcgcagacaccccctggtctacgtcgtgagtctgctgattcctaacatc
tttctcatgctggtggacctggggagcttctatgtgccacccaactgccaagccaggatt
gtgttcaagaccagtgtgctggtgggctacaccgtcttcagggtcaacatgtccaaccag
gtgccacggagtgtagggagcacccctctgattg

DBGET integrated database retrieval system