KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664729
Entry
104664729         CDS       T03989                                 

Gene name
GSTP1
Definition
(RefSeq) glutathione S-transferase P
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00480  Glutathione metabolism
rro00980  Metabolism of xenobiotics by cytochrome P450
rro00982  Drug metabolism - cytochrome P450
rro00983  Drug metabolism - other enzymes
rro01100  Metabolic pathways
rro01524  Platinum drug resistance
rro05200  Pathways in cancer
rro05204  Chemical carcinogenesis
rro05215  Prostate cancer
rro05225  Hepatocellular carcinoma
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    104664729 (GSTP1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    104664729 (GSTP1)
   00982 Drug metabolism - cytochrome P450
    104664729 (GSTP1)
   00983 Drug metabolism - other enzymes
    104664729 (GSTP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104664729 (GSTP1)
   05204 Chemical carcinogenesis
    104664729 (GSTP1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104664729 (GSTP1)
   05215 Prostate cancer
    104664729 (GSTP1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104664729 (GSTP1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104664729 (GSTP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rro02000]
    104664729 (GSTP1)
Enzymes [BR:rro01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     104664729 (GSTP1)
Transporters [BR:rro02000]
 Other transporters
  Pores ion channels [TC:1]
   104664729 (GSTP1)
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2
Other DBs
NCBI-GeneID: 104664729
NCBI-ProteinID: XP_010364630
UniProt: A0A2K6NSI4
LinkDB
Position
15
AA seq 210 aa
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD
LTLYQSNTFLRHLGRTLGLYGKDQREAALVDMVNDGVEDLRCKYLSLIYTNYEAGKDDYV
KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY
VARLSARPKLKAFLASPEHVNLPINGNGKQ
NT seq 633 nt   +upstreamnt  +downstreamnt
atgccgccctacaccgtggtctacttcccagttcgaggccgctgcgcggccctgcgcatg
ctgctggcagaccagggccagagctggaaggaggaggtggtaacagtggagacctggcaa
gagggctctctcaaagcctcctgcctgtatgggcagctccccaagttccaggacggagac
ctcaccctgtaccagtccaataccttcctgcgtcacctgggccgcactcttgggctctat
gggaaggaccagcgggaggcagccctggtggacatggtgaatgatggcgtggaggacctc
cgctgcaaatacctctccctcatctacaccaactacgaggcgggcaaggatgactatgtg
aaggcattgcccgggcaactgaagccttttgagaccctgctgtcccagaaccagggaggc
aagaccttcattgtgggagaccagatctccttcgctgactacaacctgctggacttgctg
ctgatccatgaggtcctggcccccggctgcctggatgcgttccccttgctctcggcctat
gtggcgcgcctcagtgcccggcccaagctcaaggctttcctggcctcccctgagcatgtg
aacctccccatcaatggcaacgggaaacagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680184
Entry
104680184         CDS       T03989                                 

Definition
(RefSeq) glutathione S-transferase P
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00480  Glutathione metabolism
rro00980  Metabolism of xenobiotics by cytochrome P450
rro00982  Drug metabolism - cytochrome P450
rro00983  Drug metabolism - other enzymes
rro01100  Metabolic pathways
rro01524  Platinum drug resistance
rro05200  Pathways in cancer
rro05204  Chemical carcinogenesis
rro05215  Prostate cancer
rro05225  Hepatocellular carcinoma
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    104680184
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    104680184
   00982 Drug metabolism - cytochrome P450
    104680184
   00983 Drug metabolism - other enzymes
    104680184
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104680184
   05204 Chemical carcinogenesis
    104680184
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104680184
   05215 Prostate cancer
    104680184
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104680184
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104680184
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rro02000]
    104680184
Enzymes [BR:rro01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     104680184
Transporters [BR:rro02000]
 Other transporters
  Pores ion channels [TC:1]
   104680184
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2
Other DBs
NCBI-GeneID: 104680184
NCBI-ProteinID: XP_010384323
UniProt: A0A2K6NSI4
LinkDB
Position
3
AA seq 210 aa
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD
LTLYQSNTFLRHLGRTLGLYGKDQREAALVDMVNDGVEDLRCKYLSLIYTNYEAGKDDYV
KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY
VARLSARPKLKAFLASPEHVNLPINGNGKQ
NT seq 633 nt   +upstreamnt  +downstreamnt
atgccgccctacaccgtggtctacttcccagttcgaggccgctgcgcggccctgcgcatg
ctgctggcagaccagggccagagctggaaggaggaggtggtaacagtggagacctggcaa
gagggctctctcaaagcctcctgcctgtatgggcagctccccaagttccaggacggagac
ctcaccctgtaccagtccaataccttcctgcgtcacctgggccgcactcttgggctctat
gggaaggaccagcgggaggcagccctggtggacatggtgaatgatggcgtggaggacctc
cgctgcaaatacctctccctcatctacaccaactacgaggcgggcaaggatgactatgtg
aaggcattgcccgggcaactgaagccttttgagaccctgctgtcccagaaccagggaggc
aagaccttcattgtgggagaccagatctccttcgctgactacaacctgctggacttgctg
ctgatccatgaggtcctggcccccggctgcctggatgcgttccccttgctctcggcctat
gtggcgcgcctcagtgcccggcccaagctcaaggctttcctggcctcccctgagcatgtg
aacctccccatcaatggcaacgggaaacagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682897
Entry
104682897         CDS       T03989                                 

Definition
(RefSeq) glutathione S-transferase P
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00480  Glutathione metabolism
rro00980  Metabolism of xenobiotics by cytochrome P450
rro00982  Drug metabolism - cytochrome P450
rro00983  Drug metabolism - other enzymes
rro01100  Metabolic pathways
rro01524  Platinum drug resistance
rro05200  Pathways in cancer
rro05204  Chemical carcinogenesis
rro05215  Prostate cancer
rro05225  Hepatocellular carcinoma
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    104682897
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    104682897
   00982 Drug metabolism - cytochrome P450
    104682897
   00983 Drug metabolism - other enzymes
    104682897
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104682897
   05204 Chemical carcinogenesis
    104682897
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104682897
   05215 Prostate cancer
    104682897
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104682897
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104682897
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rro02000]
    104682897
Enzymes [BR:rro01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     104682897
Transporters [BR:rro02000]
 Other transporters
  Pores ion channels [TC:1]
   104682897
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2
Other DBs
NCBI-GeneID: 104682897
NCBI-ProteinID: XP_030784012
LinkDB
Position
4
AA seq 210 aa
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD
LTLYQSNTFLRHLGRTLGLYGKDQREAALVDMVNDGVEDLRCKYLSLIYTNYEAGKDDYV
KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY
VARLSARPKLKAFLASPEHVNLPINGNGKQ
NT seq 633 nt   +upstreamnt  +downstreamnt
atgccgccctacaccgtggtctacttcccagttcgaggccgatgcgcggccctgcgcatg
ctgctggcagaccagggccagagctggaaggaggaggtggtaacagtggagacctggcaa
gagggctctctcaaagcctcctgcctgtatgggcagctccccaagttccaggacggagac
ctcaccctgtaccagtccaataccttcctgcgtcacctgggccgcactcttgggctctat
gggaaggaccagcgggaggcagccctggtggacatggtgaatgatggcgtggaggacctc
cgctgcaaatacctctccctcatctacaccaactacgaggcgggcaaggatgactatgtg
aaggcattgcccgggcaactgaagccttttgagaccctgctgtcccagaaccagggaggc
aagaccttcattgtgggagaccagatctccttcgctgactacaacctgctggacttgctg
ctgatccatgaggtcctggcccccggctgcctggatgcgttccccttgctctcggcctat
gtggcgcgcctcagtgcccggcccaagctcaaggctttcctggcctcccctgagcatgtg
aacctccccatcaatggcaacgggaaacagtga

DBGET integrated database retrieval system