KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664815
Entry
104664815         CDS       T03989                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01523  Antifolate resistance
rro04010  MAPK signaling pathway
rro04014  Ras signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04064  NF-kappa B signaling pathway
rro04066  HIF-1 signaling pathway
rro04071  Sphingolipid signaling pathway
rro04137  Mitophagy - animal
rro04151  PI3K-Akt signaling pathway
rro04210  Apoptosis
rro04211  Longevity regulating pathway
rro04218  Cellular senescence
rro04380  Osteoclast differentiation
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04623  Cytosolic DNA-sensing pathway
rro04625  C-type lectin receptor signaling pathway
rro04657  IL-17 signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04668  TNF signaling pathway
rro04722  Neurotrophin signaling pathway
rro04917  Prolactin signaling pathway
rro04920  Adipocytokine signaling pathway
rro04926  Relaxin signaling pathway
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05030  Cocaine addiction
rro05132  Salmonella infection
rro05133  Pertussis
rro05134  Legionellosis
rro05135  Yersinia infection
rro05140  Leishmaniasis
rro05142  Chagas disease
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05203  Viral carcinogenesis
rro05212  Pancreatic cancer
rro05215  Prostate cancer
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05222  Small cell lung cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05321  Inflammatory bowel disease
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104664815 (RELA)
   04014 Ras signaling pathway
    104664815 (RELA)
   04064 NF-kappa B signaling pathway
    104664815 (RELA)
   04668 TNF signaling pathway
    104664815 (RELA)
   04066 HIF-1 signaling pathway
    104664815 (RELA)
   04071 Sphingolipid signaling pathway
    104664815 (RELA)
   04024 cAMP signaling pathway
    104664815 (RELA)
   04151 PI3K-Akt signaling pathway
    104664815 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    104664815 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    104664815 (RELA)
   04218 Cellular senescence
    104664815 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104664815 (RELA)
   04621 NOD-like receptor signaling pathway
    104664815 (RELA)
   04622 RIG-I-like receptor signaling pathway
    104664815 (RELA)
   04623 Cytosolic DNA-sensing pathway
    104664815 (RELA)
   04625 C-type lectin receptor signaling pathway
    104664815 (RELA)
   04660 T cell receptor signaling pathway
    104664815 (RELA)
   04658 Th1 and Th2 cell differentiation
    104664815 (RELA)
   04659 Th17 cell differentiation
    104664815 (RELA)
   04657 IL-17 signaling pathway
    104664815 (RELA)
   04662 B cell receptor signaling pathway
    104664815 (RELA)
   04062 Chemokine signaling pathway
    104664815 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    104664815 (RELA)
   04917 Prolactin signaling pathway
    104664815 (RELA)
   04926 Relaxin signaling pathway
    104664815 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104664815 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104664815 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    104664815 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104664815 (RELA)
   05202 Transcriptional misregulation in cancer
    104664815 (RELA)
   05203 Viral carcinogenesis
    104664815 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104664815 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    104664815 (RELA)
   05221 Acute myeloid leukemia
    104664815 (RELA)
   05220 Chronic myeloid leukemia
    104664815 (RELA)
   05215 Prostate cancer
    104664815 (RELA)
   05222 Small cell lung cancer
    104664815 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    104664815 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104664815 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    104664815 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    104664815 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104664815 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104664815 (RELA)
   04931 Insulin resistance
    104664815 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104664815 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104664815 (RELA)
   05135 Yersinia infection
    104664815 (RELA)
   05133 Pertussis
    104664815 (RELA)
   05134 Legionellosis
    104664815 (RELA)
   05152 Tuberculosis
    104664815 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104664815 (RELA)
   05170 Human immunodeficiency virus 1 infection
    104664815 (RELA)
   05162 Measles
    104664815 (RELA)
   05164 Influenza A
    104664815 (RELA)
   05161 Hepatitis B
    104664815 (RELA)
   05160 Hepatitis C
    104664815 (RELA)
   05168 Herpes simplex virus 1 infection
    104664815 (RELA)
   05163 Human cytomegalovirus infection
    104664815 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104664815 (RELA)
   05169 Epstein-Barr virus infection
    104664815 (RELA)
   05165 Human papillomavirus infection
    104664815 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104664815 (RELA)
   05145 Toxoplasmosis
    104664815 (RELA)
   05140 Leishmaniasis
    104664815 (RELA)
   05142 Chagas disease
    104664815 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    104664815 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104664815 (RELA)
Transcription factors [BR:rro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    104664815 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 104664815
NCBI-ProteinID: XP_010364772
UniProt: A0A2K6NIX2
LinkDB
Position
15
AA seq 551 aa
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAITQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLCLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSPLSTINY
DEFPTMVFPSGQIRQASALASAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA
MVPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPTVFTDLASVDNSEFQQLLNQ
GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIVDM
DFSALLSQISS
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggacgaactgttccctctcatcttcccggcagagccagcccaggcctctggcccctat
gtggagatcattgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggg
cgctccgctggcagcatcccaggcgagaggagcacggataccaccaagacccaccccacc
atcaagatcaatggctacacaggaccagggacagtacgcatctccctagtcaccaaggac
cctcctcaccggcctcacccccatgagcttgtaggaaaggactgccgggatggcttctat
gaggctgagctctgcccggaccgctgcatccacagtttccagaacctgggaatccagtgt
gtgaagaagcgggacctggagcaggctatcactcagcgcatccagacgaacaacaatccc
ttccaagttcctatcgaagaacagcgtggggactacgacctgaatgctgtgcggctctgc
ttccaggtgacagtgcgggatccatcaggcaggcccctctgcctgccacctgtcctttct
catcccatctttgacaaccgtgcccccaacactgccgaactcaagatctgccgagtgaac
cgaaactctggcagctgcctcggtggggatgagatcttcctactgtgtgacaaggtgcag
aaagaggacattgaggtgtatttcacgggaccaggctgggaggcccgaggctccttttcg
caagctgatgtgcaccgacaagtggccattgtgttccggacccctccctacgcagacccc
agcctgcaggctcctgtgcgtgtctccatgcagctgcggcggccttccgaccgggagctt
agtgagcccatggaattccagtacctgccagatacagacgatcgtcaccggattgaggag
aaacgcaaaaggacatatgagaccttcaagagcatcatgaagaagagtcctttcagcgga
cccactgacccccggcctccacctcggcgcattgctgtgccttcccgcagctcagcttct
gttcccaagccagcaccccagccctatccctttacgtcacccctgagcaccatcaactat
gatgagtttcccaccatggtgtttccttctgggcagataaggcaggcctcagccttggcc
tcggcccctccccaagtactgccccaggctccagcccctgcccctgctccagccatggta
tcagctctggcccaggccccagcccctgtcccagtcctagccccaggccctcctcaggct
atggtcccacctgcccccaagcccacccaggctggggaaggaacgctgtcagaggccctg
ctgcagctgcagtttgatgatgaagacctgggggccttgcttggcaacagcacagaccca
accgtgttcacagacctggcatcagtcgacaactccgagtttcagcagctgctgaaccag
ggcatacctgtagccccccacacaactgagcccatgttgatggagtaccctgaggctata
actcgcctagtgacaggggcccagaggccccctgacccagctcctgctccactgggagcc
ccggggctccccaacggcctcctttcaggagatgaagacttctcctccattgtggacatg
gacttctcagccctgctgagtcagatcagctcctaa

DBGET integrated database retrieval system