KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664820
Entry
104664820         CDS       T03989                                 

Gene name
LRP5
Definition
(RefSeq) low-density lipoprotein receptor-related protein 5 isoform X1
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04928  Parathyroid hormone synthesis, secretion and action
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05200  Pathways in cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104664820 (LRP5)
   04150 mTOR signaling pathway
    104664820 (LRP5)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    104664820 (LRP5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104664820 (LRP5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104664820 (LRP5)
   05226 Gastric cancer
    104664820 (LRP5)
   05224 Breast cancer
    104664820 (LRP5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104664820 (LRP5)
   05022 Pathways of neurodegeneration - multiple diseases
    104664820 (LRP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104664820 (LRP5)
Membrane trafficking [BR:rro04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    104664820 (LRP5)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL Insulin_TMD DUF5653
Other DBs
NCBI-GeneID: 104664820
NCBI-ProteinID: XP_030774345
LinkDB
Position
15
AA seq 1627 aa
MRELLQDPCRSGVPLGARCWTPVGLLALLFLEGRRSPAQRPPASPLLLFANRRDVRLVDA
GGVKLESTIVVSGLEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAVQNVVISGLV
SPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWT
DWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSF
RQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGGKRKEILSALYSPMDIQVLS
QERQPFFHTRCEEDNGGCSHLCLLSPREPFYTCACPTGVQLQDNGRTCKAGAEEVLLLAR
RTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQ
TLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIALHP
VMGLMYWTDWGENPKIECANLDGQERRVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIE
VINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDL
MGLKAVNVAKVVGTNPCADRNGGCSHLCFFTPHATRCGCPIGLELLSDMKTCIVPEAFLV
FTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSS
VEHVVEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLAL
DPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMI
ESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGQNRTLIQGHLDF
VMDILVFHSSRQDGLNDCMHNNGQCGQLCLAIPGGHRCGCASHHTLDPSSRNCSPPTTFL
LFSQKSAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGT
QPFVLTSLSQGQNPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLSGEAMGVVLRGDRDK
PRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNILGKLFW
VDADLKRIESCDLSGANRLTLEDANIVQPLGLTVLGKHLYWIDRQQQMIERVEKTTGDKR
TRVQGRVAHLTGIHAVEEVSQEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQ
NLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARG
QCVDLRLRCDGEADCQDRSDEADCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDEL
MCEITKPPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVS
GTPHVPLNFIAPGGSQHGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSS
TKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPATARPYRPYIIRGMAPPTTPCSTDVC
DSDYSTSRWKASKYYLDLNSDSDPYPPPPTPHSQYMSAEDSCPPSPATERSYFHLFPPPP
SPCTDSS
NT seq 4884 nt   +upstreamnt  +downstreamnt
atgagagagctcctccaggatccatgcaggtctggcgtgccactgggtgctaggtgctgg
actccggtcggcctgcttgctctgcttttcttggagggtcgaaggagccctgctcagaga
ccaccagcctcgccactcctgctatttgccaaccgccgggacgtacggctggtggacgct
ggtggagtcaagctggagtccaccattgtggtcagcggcctggaggatgcggccgcagtg
gacttccagttctccaagggagccgtgtactggacagatgtgagcgaggaggccatcaag
cagacctacctgaaccagacgggggccgccgtgcagaatgtggtcatctccggcctggtc
tcgcctgacggccttgcctgcgactgggtgggcaagaagctgtactggacggactcagag
accaaccgcatcgaggtggccaacctcaatggcacatcccggaaggtcctcttctggcag
gaccttgaccagccaagggccatcgccttggatcctgctcacgggtacatgtactggaca
gattggggcgagacgccccggatcgagcgggcggggatggacggcagcacccggaagatc
attgtggactcggacatttactggcccaatggactgaccattgacctagaggagcagaag
ctctactgggccgatgccaagctcagcttcatccaccgtgccaatctagatggctcgttc
cggcagaaggtggtggagggcagcctgacacaccccttcgccctgacgctctccggggac
actctgtactggacggactggcagacccgctccatccatgcctgcaacaagcgcactggg
gggaagaggaaggagatcctgagcgccctctactcacccatggacattcaggtgctgagc
caggagcggcagcctttcttccacactcgctgtgaggaggacaatggcggctgctcccac
ctgtgcctgctgtccccaagggagcctttctacacatgcgcctgtcccacgggtgtgcag
ctgcaggacaacggcaggacgtgtaaggcaggagccgaggaggtgctgctgctggcccgg
cggacagacctacggaggatctcgctggacacgccggacttcaccgacattgtgctgcag
gtggatgacatccggcatgccattgccatcgactacgacccactggagggctatgtctac
tggacggatgacgaggtgcgggccatccgcagggcgtacctggatgggtctggggcgcag
acgctggtcaacaccgagatcaatgaccccgatggcatcgcagttgactgggtggcccga
aacctctactggaccgacacgggcacggaccgcatcgaggtgacgcgcctgaacggcacc
tcccgcaagatcctggtgtcagaggacctggacgagccccgagccatcgcactgcacccc
gtgatgggcctcatgtactggacagactggggagagaaccctaaaatcgagtgtgccaat
ctggacgggcaggagcggcgtgtgctggtcaatgcctccctcgggtggcccaacggcctg
gccctggacctgcaggaggggaagctctactggggagacgccaagacagacaagatcgag
gtgatcaatgttgacgggacgaagaggcggaccctcctggaggacaagctcccgcacatt
ttcgggttcacactgctgggggactttatctactggactgactggcagcgccgcagcatt
gagcgggtgcacaaggtcaaggccagccgggacgtcatcattgaccagctgcccgacctg
atggggctcaaagccgtgaatgtggccaaggtcgtcggaaccaacccgtgtgcggacagg
aacggggggtgcagccacctgtgcttcttcacgccccacgcaacccggtgtggctgcccc
atcggcctggagctactgagtgacatgaagacctgcatcgtgcccgaggccttcttggtc
ttcactagcagagccgccatccacaggatctccctcgagaccaacaacaacgacgtggcc
atcccactcacgggcgtcaaggaggcctcagccctggacttcgacgtgtccaacaaccac
atctactggacagacgtcagcctgaagaccatcagccgcgccttcatgaatgggagttcg
gtggagcacgtggtggagtttggccttgactaccccgagggcatggccgttgactggatg
ggcaagaacctctactgggccgacaccgggaccaacaggatcgaagtggcgaggctggac
gggcagttccggcaagtcctcgtgtggagggacttggacaacccgaggtcgctggccctg
gatcccaccaaaggctacatctactggaccgagtggggcggcaagccgaggatcgtgcgg
gccttcatggacgggaccaactgcatgacgctggtggacaaggtgggccgggccaacgac
ctcaccattgactacgctgaccagcgcctctactggaccgacctggacaccaacatgatt
gagtcgtccaacatgctgggtcaggagcgggttgtgattgccgacgacctcccacacccg
ttcggtctgacgcagtacagcgattatatctactggacggactggaatctgcacagcatc
gagcgggccgacaagaccagcggccagaaccgcaccctcatccagggccacctggacttc
gtgatggacatcctagtgttccactcctcccgccaggatggcctcaacgactgcatgcac
aacaacgggcagtgcgggcagctgtgccttgccatccccggcggccaccgctgcggctgt
gcctcacaccacaccctggaccccagcagccgcaactgcagcccgcccaccaccttcttg
ctgttcagccagaaatctgccatcagtcggatgatcccagatgaccagcacagcccggat
ctcatcctgcccctgcatgggctgaggaacgtcaaagccatcgactatgacccactggac
aagttcatctactgggtggacggccgccagaacatcaagcgagccaaggacgatgggacc
cagccctttgttttgacctctctgagccaaggccaaaacccagacaggcagccccacgac
ctcagcatcgacatctacagccggacgctgttctggacgtgcgaggccaccaataccatc
aacgtccacaggctgagcggggaagccatgggggtggtgctgcgtggggaccgcgacaag
cccagggccatcgtcgtcaatgcggagcgagggtacctgtacttcaccaacatgcaggac
cgggcagccaagatcgaacgcgcggccctggacggcactgagcgcgaggtcctcttcacc
accggcctcatccgccccgtggccctggtggtggacaacatactgggcaagctgttctgg
gtggacgcagacctgaagcgcattgagagctgcgacctgtcaggggccaaccgcctgacc
ctggaggacgccaacatcgtgcagcctctgggcctgaccgtccttggcaagcacctctac
tggatcgaccgccaacagcagatgatcgagcgtgtggagaagaccaccggggacaagcgg
actcgtgtccagggccgcgtcgcccacctcactggcatccacgcagtggaggaagtcagc
caggaggagttctcagcccacccatgtgcccgtgacaatggtggctgctcccacatctgt
attgccaagggtgatgggacaccacggtgctcatgcccggtccacctcgtgctcctgcag
aacctgctgacctgtggagagccgcccacctgctccccagaccagtttgcatgtgccacg
ggggagatcgactgtatccccggggcctggcgctgtgacggctttcccgagtgcgacgac
cagagcgacgaggagggctgccccgtgtgctctgccgcccagttcccctgcgcgcggggc
cagtgtgtggacctgcgcctgcgctgcgatggcgaggccgactgtcaggaccgctcagac
gaggcggactgtgacgccatctgcctgcccaaccagtttcggtgtgccagcggccagtgt
gtcctcatcaagcagcagtgcgactccttccctgactgcattgacggttccgatgagctc
atgtgtgaaatcaccaagccgccctcagacgacagcccggcccacagcagtgccatcggg
cccgtcattggcatcatcctctccctcttcgtcatgggtggtgtctattttgtgtgccag
cgcgtggtgtgccagcgctacgcgggggccaacgggcccttcccgcacgagtatgtcagc
gggaccccacacgtgcccctcaatttcatagccccaggcggttcccagcatggccccttc
acaggcatcgcgtgtggaaagtccatgatgagctccgtgagcctgatggggggccggggc
ggggtgcccctctacgaccgcaaccacgtcacaggggcgtcgtccagcagctcgtccagc
acgaaggccacgctgtacccgccgatcctgaacccgccgccctccccggccacggacccc
tccctgtacaacatggacatgttctactcttcaaacattccggccaccgcgagaccgtac
aggccctacatcattcgaggaatggcgccccccacgacaccctgcagcaccgacgtgtgt
gacagtgactacagcaccagccgctggaaggccagcaagtactacctggatttgaactcg
gactcagacccctacccgcccccacccacgccccacagccagtacatgtcggcagaggac
agctgcccgccctcgcccgccaccgagaggagctacttccacctcttcccaccccctccg
tccccctgcacggactcatcctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668335
Entry
104668335         CDS       T03989                                 

Gene name
LRP6
Definition
(RefSeq) low-density lipoprotein receptor-related protein 6 isoform X1
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04928  Parathyroid hormone synthesis, secretion and action
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05200  Pathways in cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104668335 (LRP6)
   04150 mTOR signaling pathway
    104668335 (LRP6)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    104668335 (LRP6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104668335 (LRP6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104668335 (LRP6)
   05226 Gastric cancer
    104668335 (LRP6)
   05224 Breast cancer
    104668335 (LRP6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104668335 (LRP6)
   05022 Pathways of neurodegeneration - multiple diseases
    104668335 (LRP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104668335 (LRP6)
Membrane trafficking [BR:rro04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    104668335 (LRP6)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL cEGF
Other DBs
NCBI-GeneID: 104668335
NCBI-ProteinID: XP_010369300
UniProt: A0A2K6RE06
LinkDB
Position
10
AA seq 1613 aa
MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVF
GHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQDLDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSE
IYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWT
DWSTHSILACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNTIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLS
IDIYSRYIYWTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERS
PKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLE
DSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQ
EYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGE
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEK
NCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGV
IVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMS
RGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTM
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
NT seq 4842 nt   +upstreamnt  +downstreamnt
atgggggccgtcctgaggagcctcctggcctgcagcttctgtgtgctcctgagagcggcc
cctttgttgctttatgcaaacagacgggacttgcgattggttgatgctacaaatggcaaa
gagaatgctacgattgtagttggaggcttggaggatgcagctgcggtggactttgtgttt
ggtcatggcttgatatactggagtgatgtcagtgaagaagccattaaacgaacagaattt
aacaaaactgagagtgtacagaatgttgttgtttctggattattgtcccctgatgggctg
gcatgtgattggcttggagaaaaattgtactggacagattctgaaactaatcggattgaa
gtttctaatttagatggatctttacgaaaagttttattttggcaagacttggatcaaccc
agagctattgccttagatccttcaagtgggttcatgtactggacagactggggagaagtg
ccaaagatagaacgtgctggaatggatggttcaagtcgcttcattataataaacagtgaa
atttactggccaaatggactgactttggattatgaagaacaaaagctttattgggcagat
gcaaaacttaatttcatccacaaatcaaatctggatggaacaaatcggcaggcagtggtt
aaaggttcgcttccacatccttttgccttgacgttatttgaggacatattgtactggact
gactggagcacacactccattttggcttgcaacaagtatactggtgagggtctgcgtgaa
atccattctaacatcttctctcccatggatatacatgccttcagccaacagaggcagcca
aatgccacaaatccatgtggaattgacaatgggggttgttcccatttgtgtttgatgtct
ccagtcaagcctttttatcagtgtgcttgtcccactggggtcaaactcctggagaatgga
aaaacctgcaaagatggtgccacagaattactgcttttagctcgaaggacagacttgaga
cgcatttctttggatacaccagattttacagacattgttctgcagttagaagacatccgt
catgccattgccatagattacgatcctgtggaaggctacatctactggactgatgatgaa
gtgagggccatacgccgttcatttatagatggatctggcagtcagtttgtggtcactgct
caaattgcccatcctgatggtattgctgtggactgggttgcacgaaatctttactggacg
gacactggcactgatcgaatagaagtgacaaggctcaatgggaccatgaggaagatcttg
atttcagaggacttagaggaaccccgggctattgtgttagatcccatggttgggtacatg
tattggactgattggggagaaattccgaaaattgagcgagcagctctggatggttctgac
cgtgtagtattggttaacacttctcttggatggccaaatggtttagccttggattatgat
gaaggcaaaatatactggggagatgccaaaacagacaagattgaggttatgaatactgat
ggcactgggagacgagtactagtggaggacaaaattcctcacatatttggatttactttg
ttgggtgactacgtttactggactgactggcagaggcgtagcattgaaagagtacataaa
cgaagtgcagagagggaagtgatcatagatcagctgcctgacctcatgggcctaaaggcc
acaaatgttcatcgagtgattggttccaacccctgcgctgaggaaaatgggggatgcagc
catctctgcctttacagacctcagggccttcgctgtgcttgccctattggctttgaactc
atcagtgacatgaagacctgcattgtcccagaggctttccttttgttttcacggagagca
gacatcagacgaatttctttggaaacaaacaataataatgtggctattccactcactggt
gtcaaggaagcttctgctttggattttgatgtgacagacaaccgaatttattggactgat
atatcactcaagaccatcagcagagcctttatgaatggcagtgcactggaacatgtggta
gaattcggcttagattatccagaaggcatggcagtagactggcttgggaagaacttgtac
tgggcagacacaggaacgaatcgaattgaggtgtcaaagttggatggacagcatcgacaa
gttttggtgtggaaagacctagatagtcccagagctctggcgttggaccctgccgaagga
tttatgtattggactgaatggggtggaaaacctaagatagacagagctgcaatggatgga
agtgaacgcactaccttagttccaaatgtggggcgggcaaatggcctgactattgattat
gctaaaaggaggctttattggacagacctggacaccaacttaatagaatcttcaaatatg
cttggactcaaccgtgaagttatagcagatgacttgcctcatccttttggcttaactcag
taccaagattatatctactggacggactggagccgacgcagcattgagcgtgccaacaaa
accagtggccaaaaccgcaccatcattcaaggccatttggattatgtgatggacatcctc
gtctttcactcatctcgacagtcagggtggaatgaatgtgcttccagcaatgggcactgc
tcccacctctgcttggctgtgccagttgggggttttgtttgtggatgccctgcccactac
tctcttaatgctgacaacaggacttgtagtgctcctaccactttcctgctcttcagtcag
aagagtgccatcaaccgcatggtgattgatgaacaacagagccccgacatcatccttccc
atccacagccttcggaatgtccgggccattgactatgaccctctggacaagcaactctat
tggattgactcacgacaaaacacgatccgaaaggcacaagaagatggcagccagggcttt
actgtggttgtgagctcagttccaagtcagaacctggaaatacaaccctatgacctaagc
attgatatttacagccgctacatctactggacttgtgaggctaccaatgtcattaatgtg
acaagattagatgggagatcaattggtgtggtgctaaaaggcgagcaggacagacctcga
gccattgtggtaaacccagagaaagggtatatgtattttaccaatcttcaggaaaggtct
cctaaaattgaacgggctgctttggatgggaccgaacgggaggtcctctttttcagtggc
ttaagtaaaccaattgctttagcccttgatagcaggctgggcaagctcttttgggctgat
tcagacctccggcgaattgaaagcagtgatctctcaggtgctaaccggatagtattagaa
gactccaacattttgcagcctgtgggacttactgtgtttgaaaactggctctattggatt
gataaacagcagcaaatgattgaaaaaattgatatgacaggtcgagagggtagaacaaaa
gtccaggctcgaattgcccagcttagtgacattcatgcagtaaaggagctgaaccttcaa
gaatacagacagcatccttgtgctcaggataatggtggctgttcacatatttgtcttgta
aagggagatggtactacaaggtgttcttgccccatgcacctggttctgcttcaagatgag
ctatcatgtggagaacctccaacatgttctcctcagcagtttacttgtttcacgggggaa
attgactgtatccctgtggcttggcgatgcgatgggtttactgaatgtgaagaccacagt
gatgaactcaattgtcctgtatgctcagagtcccagttccagtgtgccagtgggcagtgt
attgatggtgccctccgatgcaatggagatgcaaactgccaggacaaatcagatgagaag
aactgtgaagtgctttgtttaattgatcaattccgctgtgccaatggtcagtgcattgga
aaacacaagaagtgtgatcataatgtggattgcagtgacaagtcagatgaactggattgt
tatccaactgaagaaccagcaccacaggccaccaatacagttggttctgttattggagta
attgtcaccatttttgtgtctggaactatatactttatctgccagaggatgttgtgtcca
cgtatgaagggagatggggaaactatgactaatgactatgtagttcatggaccagcttct
gtgcctcttggttatgtgccacacccaagttctttgtcaggatctcttccaggaatgtct
cgaggtaaatcaatgattagctccctcagtatcatggggggaagcagtggacccccctac
gaccgagcccatgttacaggagcatcatcaagtagttcttcaagcaccaaaggcacttac
ttccctgcaattttgaaccctccaccatccccagccacagagcgatcgcattacactatg
gaatttggatattcttcaaacagtccttccactcataggtcatacagctacaggccatat
agctatcggcactttgcaccccccaccacaccctgcagcacagatgtttgtgacagtgac
tatgctcctagtcggagaatgacctcagtggcaacagccaagggctacaccagtgacttg
aactatgattcagaacctgtgcccccaccccccacaccccgaagccaatacttgtcggca
gaggagaactatgaaagctgcccaccttctccatacacagagaggagctattctcatcac
ctctacccaccgccaccctctccctgtacagactcctcttga

DBGET integrated database retrieval system