KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664823
Entry
104664823         CDS       T03989                                 

Gene name
PPP1CA
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-alpha catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro03015  mRNA surveillance pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04114  Oocyte meiosis
rro04218  Cellular senescence
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04390  Hippo signaling pathway
rro04510  Focal adhesion
rro04611  Platelet activation
rro04720  Long-term potentiation
rro04728  Dopaminergic synapse
rro04750  Inflammatory mediator regulation of TRP channels
rro04810  Regulation of actin cytoskeleton
rro04910  Insulin signaling pathway
rro04921  Oxytocin signaling pathway
rro04931  Insulin resistance
rro05031  Amphetamine addiction
rro05034  Alcoholism
rro05168  Herpes simplex virus 1 infection
rro05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    104664823 (PPP1CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    104664823 (PPP1CA)
   04024 cAMP signaling pathway
    104664823 (PPP1CA)
   04022 cGMP-PKG signaling pathway
    104664823 (PPP1CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104664823 (PPP1CA)
   04218 Cellular senescence
    104664823 (PPP1CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104664823 (PPP1CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104664823 (PPP1CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104664823 (PPP1CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104664823 (PPP1CA)
   04921 Oxytocin signaling pathway
    104664823 (PPP1CA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104664823 (PPP1CA)
   04270 Vascular smooth muscle contraction
    104664823 (PPP1CA)
  09156 Nervous system
   04728 Dopaminergic synapse
    104664823 (PPP1CA)
   04720 Long-term potentiation
    104664823 (PPP1CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104664823 (PPP1CA)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104664823 (PPP1CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    104664823 (PPP1CA)
   05034 Alcoholism
    104664823 (PPP1CA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    104664823 (PPP1CA)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    104664823 (PPP1CA)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     104664823 (PPP1CA)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     104664823 (PPP1CA)
Transcription machinery [BR:rro03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     104664823 (PPP1CA)
Messenger RNA biogenesis [BR:rro03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     104664823 (PPP1CA)
Spliceosome [BR:rro03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    104664823 (PPP1CA)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 104664823
NCBI-ProteinID: XP_030774099
LinkDB
Position
15
AA seq 330 aa
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgtccgatagcgagaagctcaaccttgactcgatcatcgggcgcctgctagaagtgcag
ggctcgcggcctggcaagaatgtacagctgacagagaacgagatccgcggtctgtgcctg
aaatcccgggagattttcctgagccagcccattcttctggagctggaggcacccctcaag
atctgcggtgatatacacggccagtactacgaccttctgcgactatttgagtatggcggt
ttccctccggagagcaactacctctttctgggggactatgtggacaggggcaagcagtcc
ttggagaccatctgcctgctgctggcctataagatcaagtaccccgagaacttcttcctg
ctccgtgggaaccacgagtgcgccagcatcaaccgcatctacggtttctacgatgagtgc
aagagacgctacaacatcaaactgtggaaaacgttcactgactgcttcaactgcctgccc
atcgcggccatagtggacgaaaagatcttttgctgccacggaggcctctccccggacctg
cagtccatggagcagattcggcggatcatgcggcccacagatgtgcctgaccagggcctg
ctgtgtgacctcctgtggtctgaccctgacaaggacgtgcagggctggggcgagaacgac
cgtggcgtctcttttacatttggagccgaggtggtggccaagttcctccacaagcacgac
ttggacctcatctgccgagcacaccaggtggtagaagatggctatgagttctttgccaag
cggcagctggtgacacttttctcagctcccaactactgtggcgagtttgataatgctggc
gccatgatgagcgtggacgagaccctcatgtgctccttccagatcctcaagcccgccgac
aagaacaaggggaagtacgggcagttcagtggcctgaaccctggaggccggcccatcacc
ccaccccgcaattccgccaaagccaagaaatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668466
Entry
104668466         CDS       T03989                                 

Gene name
PPP1CB
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-beta catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro03015  mRNA surveillance pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04114  Oocyte meiosis
rro04218  Cellular senescence
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04390  Hippo signaling pathway
rro04510  Focal adhesion
rro04611  Platelet activation
rro04720  Long-term potentiation
rro04728  Dopaminergic synapse
rro04750  Inflammatory mediator regulation of TRP channels
rro04810  Regulation of actin cytoskeleton
rro04910  Insulin signaling pathway
rro04921  Oxytocin signaling pathway
rro04931  Insulin resistance
rro05031  Amphetamine addiction
rro05034  Alcoholism
rro05168  Herpes simplex virus 1 infection
rro05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    104668466 (PPP1CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    104668466 (PPP1CB)
   04024 cAMP signaling pathway
    104668466 (PPP1CB)
   04022 cGMP-PKG signaling pathway
    104668466 (PPP1CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104668466 (PPP1CB)
   04218 Cellular senescence
    104668466 (PPP1CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104668466 (PPP1CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104668466 (PPP1CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104668466 (PPP1CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104668466 (PPP1CB)
   04921 Oxytocin signaling pathway
    104668466 (PPP1CB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104668466 (PPP1CB)
   04270 Vascular smooth muscle contraction
    104668466 (PPP1CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    104668466 (PPP1CB)
   04720 Long-term potentiation
    104668466 (PPP1CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104668466 (PPP1CB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104668466 (PPP1CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    104668466 (PPP1CB)
   05034 Alcoholism
    104668466 (PPP1CB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    104668466 (PPP1CB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    104668466 (PPP1CB)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     104668466 (PPP1CB)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     104668466 (PPP1CB)
Transcription machinery [BR:rro03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     104668466 (PPP1CB)
Messenger RNA biogenesis [BR:rro03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     104668466 (PPP1CB)
Spliceosome [BR:rro03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    104668466 (PPP1CB)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 104668466
NCBI-ProteinID: XP_010369481
UniProt: A0A2K6QEJ4
LinkDB
Position
17
AA seq 327 aa
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYGGLNSGRPVTPPRTANPPKKR
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcggacggggagctgaacgtggacagcctcatcacccggctgctggaggtacgagga
tgtcgtccaggaaagattgtgcagatgactgaagcagaagttcggggcttatgtatcaag
tctcgggagatctttctcagccagcctattcttttggaattggaagcaccgctgaaaatt
tgtggagatattcatggacaatatacggatttactgagattatttgaatatggaggtttc
ccaccagaagccaactatcttttcttaggagattatgtggacagaggaaagcagtctttg
gaaaccatttgtttgctattggcttataaaatcaaatatccagagaacttctttctctta
agaggaaaccatgagtgtgctagcatcaatcgcatttatggattctatgatgaatgcaaa
cgaagatttaatattaaattgtggaagaccttcactgattgttttaactgtctgcctata
gcagccattgtggatgagaagatcttctgttgtcatggaggattgtcaccagacctgcaa
tctatggagcagattcggagaattatgagacctactgatgtccctgatacaggtttgctc
tgtgatctgctatggtctgatccagataaggatgttcaaggctggggagaaaatgatcgt
ggtgtttcctttacttttggagctgatgtagtcagtaaatttctgaatcgtcatgattta
gatttgatttgtcgagctcatcaggtggtggaagatggatatgaattttttgctaaacga
cagttggtaaccttattttcagccccaaattactgtggcgagtttgataatgctggtgga
atgatgagtgtggatgaaactttgatgtgttcatttcagatattgaaaccatctgaaaag
aaagctaagtaccagtatggtggactgaattctggacgtcctgtcactccacctcgaaca
gctaatccaccgaagaaaaggtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674509
Entry
104674509         CDS       T03989                                 

Gene name
PPP1R12B
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12B isoform X4
  KO
K12329  protein phosphatase 1 regulatory subunit 12B
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04270  Vascular smooth muscle contraction
rro04510  Focal adhesion
rro04810  Regulation of actin cytoskeleton
rro04921  Oxytocin signaling pathway
rro05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104674509 (PPP1R12B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104674509 (PPP1R12B)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104674509 (PPP1R12B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104674509 (PPP1R12B)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104674509 (PPP1R12B)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104674509 (PPP1R12B)
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_5 PRKG1_interact Ank Ank_3 MEDS
Other DBs
NCBI-GeneID: 104674509
NCBI-ProteinID: XP_010377138
UniProt: A0A2K6QS18
LinkDB
Position
1
AA seq 1058 aa
MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGA
VFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQ
DNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQ
GVDLEQSRKEEEQQLLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAG
YELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLEM
LQKKQNVLRSEKETRNKLIESDLNSKMQSGFFKNKEKMLYEEETPKSQEMEENKESSSSS
SEEEEGEDEASESETEKEAGKKPETFVNRSNSESKSSITEQIPAPAQNTFSASSARRFSS
GLFNKPEEPKDESPSSWRLGLRKTGSHNMLSEVANSREPLRDRGSSIYRSSSSPRISALL
DNKDKERENKSYISSLAPRKLNSTSDIEEKENRESAVNLVRSGSYTRQLWRDEAKGNETP
QTIAPSTYVSTYLKSASFGRSSDPTSPYISANRNSSPATSPITIGSSTSRGSQWQPASSC
PAPISANTTASVHHGRTPHKSQADSTAEKTADNVFSSTPLCVITNHSLPSTANGVTATPV
LSITGTDSSVEAREKRRSYLTPVRDEEAESLRKARSRQARQTRRSTQGVTLTDLQEAERT
FSRSRAERQAQEQPREKPTDTEGLEGSPEKHEPSAVPATEAGEGQQPWGRSLDEEPICHR
LRCPTQPDKPTPPASPSTSRPSLYTSSHLLRTNRFSVPDSESSKTTTNTTTAKEMDKIEN
QEADLDEQSSGRLSIRERRRPKERRRGTGINFWTKDEDETDGSEEVKETWHERLSRLESG
GSNPTTSDSYGDRASARARREAREARLATLTSRVEEDSNRDYKKLYESALTENQKLKTKL
QEAQLELADIKSKLEKVTQQKQEKTSDRSSVLEMEKRERRALERKMSEMEEEMKNLHQLK
QIQTLKQMNEQLQAENRALTRVVARLSESVESSDTQEL
NT seq 3177 nt   +upstreamnt  +downstreamnt
atggcggagctggagcacctgggagggaagcgggcagagtcggcgcgaatgcggcgggca
gagcagcttcggcgctggcggggctcgctgacagagcaggagcccgcggagcgacgaggc
gcggggcggcagccgctgaccaggcgcgggagccccagggtccgcttcgaggacggtgct
gtcttcctggccgcctgctctagcggggacaccgacgaggtgagaaagcttctggcaaga
ggtgctgatatcaacacagtcaacgtggacggcttgacagccctgcaccaggcatgtatt
gatgaaaatttggatatggtgaagtttctggtggagaacagagccaatgtaaaccagcaa
gacaatgaaggctggacaccccttcatgcagcagcttcctgtggctatctcaacatagca
gagtatttcattaatcacggagccagtgtaggtattgtcaatagtgaaggtgaagttccc
tctgaccttgcagaagagccagccatgaaggatcttcttctggagcaagtaaagaagcaa
ggagtcgatctagagcagtcaagaaaagaagaagagcagcagttgttgcaggatgcccgc
cagtggctcaacagtgggaaaatagaggatgtgaggcaagctcgctcaggggctacagcc
cttcatgtggctgctgccaagggctactctgaagtcctcagacttttaatacaggctggc
tatgaactcaatgttcaggattatgatggctggactcccctccatgctgctgcacactgg
ggagtgaaggaggcttgctccatcctggcagaagcactctgtgacatggatattcgaaac
aaactgggccagacaccatttgatgtcgctgatgagggtctcgtggaacatttggagatg
ctccagaagaagcagaatgtgcttcgaagtgaaaaggagacacggaataaactcattgag
tcagacctgaacagcaagatgcagagtgggttctttaagaacaaagagaagatgctctat
gaggaggagacacctaagtcccaagaaatggaagagaacaaagaatctagtagctccagc
tcagaggaggaggaaggtgaagatgaagcttctgagtcagaaactgagaaggaggcaggt
aaaaagccggaaacctttgtcaaccgttccaactctgaaagcaagagtagcatcacggag
cagataccagcaccagctcagaataccttctctgcttcttctgctaggaggttctcttct
ggcctttttaacaagccagaagagcccaaagatgaatctccttcttcatggagattggga
ctgagaaaaactggcagccacaacatgctgagtgaggtggccaattccagggaacctcta
agggaccgaggctcttccatctaccgttcctcttcaagccctcggatttctgctctacta
gacaacaaagataaggagagagaaaacaaaagctatattagttcactagcaccccggaag
ctcaacagcacaagtgatattgaagaaaaggagaacagagaatcagctgttaatctagtg
aggagtggctcctatacccggcagctatggagggatgaagcaaagggaaatgaaacccca
cagacaattgccccctccacctatgtatcaacctacttgaaaagtgcttcatttggtaga
agtagtgaccccacaagtccctacatttcagccaatcgcaattcatctcctgctacctca
cccattaccattggttcatctacctctcggggcagccagtggcaacctgcctcttcttgc
cctgcaccaatcagtgcaaacactactgcatctgtacatcatggcaggactcctcacaaa
tcccaggctgactcgacagcagagaaaacagcagacaatgtcttttctagcaccccactc
tgtgtgatcaccaatcactctctgcctagcactgccaatggggttacagctactcctgta
ctctccattactggaacagattcgtctgtggaagccagggagaagaggaggtcctatcta
actcctgtacgggatgaggaagcagagtctttacggaaagcacgctccagacaagctcgg
cagacacgaaggtctactcaaggtgtcaccctaacggaccttcaagaagcagaaaggact
ttcagccggtcgagggcagagaggcaagctcaggagcagcctcgtgagaagcccacagac
actgaagggcttgaggggagccctgagaagcatgagccctcagcagttccagcaacagaa
gctggggagggccagcagccctggggcaggagtctggatgaagagcctatctgtcatcgc
ctgaggtgcccaactcagccagacaaacccaccccgccagcatctccttctacatcaaga
ccctcactctacaccagttcccacctgctacggacaaatagattttcagtccctgattct
gagagttcaaagactaccacaaatactacaactgcaaaggaaatggacaaaattgagaat
caagaagcagatttggatgagcagtcctctgggaggctgtccatccgagagaggaggcgg
cccaaggaacgacgaagaggtacaggcatcaatttctggacaaaggatgaggatgaaact
gatggctctgaagaggtcaaagaaacatggcatgaaagactttctaggttggaatcagga
ggtagtaatcctacaaccagtgattcttacggtgaccgggcttcagcaagagcccgtcgg
gaggcccgggaggcccgtctagccaccctgaccagtcgtgtagaagaagacagcaacaga
gattataaaaaactctatgagagtgctctgactgaaaatcaaaaactgaaaacaaaactt
caggaagcccagctagagctagcagatataaaatccaagcttgagaaggtgacccagcag
aaacaagaaaagacctctgaccgatcatcagtgctggagatggagaaacgggagaggcga
gccttggagcgcaaaatgtcagaaatggaggaagaaatgaagaacctccaccagctaaaa
cagattcaaaccttgaagcagatgaacgagcaactgcaggctgagaacagggccctgacc
cgagtggtggccagactctcggagtccgtcgagtcctcggacacccaggagctctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674755
Entry
104674755         CDS       T03989                                 

Gene name
PPP1R12C
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12C isoform X1
  KO
K17457  protein phosphatase 1 regulatory subunit 12C
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04270  Vascular smooth muscle contraction
rro04510  Focal adhesion
rro04810  Regulation of actin cytoskeleton
rro04921  Oxytocin signaling pathway
rro05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104674755 (PPP1R12C)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104674755 (PPP1R12C)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104674755 (PPP1R12C)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104674755 (PPP1R12C)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104674755 (PPP1R12C)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104674755 (PPP1R12C)
SSDB
Motif
Pfam: PRKG1_interact Ank_2 Ank_4 Ank_5 Ank_3 Ank DUF4695
Other DBs
NCBI-GeneID: 104674755
NCBI-ProteinID: XP_010377472
LinkDB
Position
12
AA seq 782 aa
MSGEDGPVAGPGAAAAAARERRREQLRQWGARAGAEPGLGERRARTVRFERAAEFLAACA
GGDLDEARLMLCAADPGPGAELDPAAPPPARAVLDSTNADGISALHQACIDENLEVVRFL
VEQGATVNQADNEGWTPLHVAASCGYLDIARYLLSHGANIAAVNSDGDLPLDLAESDPME
GLLKAEIARRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHVAAAKGYI
EVMRLLLQAGYDPELRDGDGWTPLHAAAHWGVEDACRLLAEHGGGMDSLTHAGQRPCDLA
DEEVLSLLEELARKQEDLRNQKEASQSRGQEPQAPSSSKHRRSSVCRLSSREKISLQDLS
KERRPGGAGGPPIQDEDEGEEGPTEPRPAEPRTLNGVSSPPHPSPKSPVPPEEAPFSRRF
GLLKTGSSGALGPPERRMAEGAPGAGLQRSASSSWLEGTSTQAKELRLARITPTPSRKLP
EPSALSEVTKPPPCLENSSPPSRIPEPESPAKPNVPAASTAPPADSRDRRRSYQMPVRDE
ESESQRKARSRLMRQSRRSTQGVTLTDLKEAEKSAGKAPESEKPAQSLDPFRRPRVPGVE
NSDSPARRAEAPDGQGPGPQAAREHRKVGKEWRGPAEGEEAEPADRSPESSTLEGGPSAR
RQRSQRDLNPEPEPESEEQDGGFRKLYAELRRENERLREALTETTLRLAQLKVELERATQ
RQERFAERPALLELERFERRALERKAAELEEELKALSDLRADNQRLKDENAALIRVISKL
SK
NT seq 2349 nt   +upstreamnt  +downstreamnt
atgtccggagaggatggcccggtggctggcccgggggcggcggcggcggctgcccgggag
cggcgacgggagcagctgcggcagtggggggcgcgggcgggcgccgagcctggcctcgga
gagcgccgcgcccgcaccgtccgcttcgagcgcgccgccgagttcctggcggcctgtgcg
ggcggcgacctggacgaagcgcgtctgatgctgtgcgccgcggaccccggccccggcgcc
gagctggatcccgccgcgccgccgcccgcccgcgccgtgctggactccaccaacgccgac
ggcatcagcgccctgcaccaggcctgcattgatgagaacctggaggtggtgcgcttcttg
gtagagcaaggtgccaccgtgaaccaggcggacaacgagggctggacgcccctgcacgtg
gccgcctcctgcggctacctagacatcgccaggtacctcctgagccatggggccaacatc
gccgccgtcaacagtgacggggacctgcccctggacctggccgagtcggaccctatggag
gggctgctgaaggcggagatcgcccgccgaggtgtggacgtggaggcagccaagcgggcg
gaggaggaattgctacttcatgacacaaggtgctggctgaatgggggcgccatgccagag
gcccggcacccccgcacaggtgcctctgccctgcacgtggctgctgccaagggctacatt
gaggtgatgaggttgctccttcaggctggctacgacccggagctccgggatggggacggc
tggactcccctgcacgcggcagcacactggggcgtggaggatgcctgccgcctgctggct
gagcatggcgggggcatggactcgctgacccacgcggggcagcggccctgtgacctggct
gatgaggaagtgctgagcctgttggaggaactggcccggaaacaggaggaccttcgcaac
caaaaagaagcttcccagagccgcggccaggagccccaagcgccctctagcagcaaacac
agaaggagctctgtgtgtcgtctgagcagtcgagagaagatttccctccaggacttgtcc
aaggagcgccggcctggtggggctggggggccccccatccaggacgaggatgagggggaa
gaaggtcccactgagccacgccctgcagaacccagaaccctgaatggtgtctcctcccca
ccgcaccccagtcctaagagccccgtgccgcctgaagaggcccccttctccaggcgcttt
ggcctcctgaagacagggagttctggtgccctgggtcccccggaaaggcggatggcagag
ggagcccctggagctgggctgcagcgctcggcttcctcctcctggctggaagggacctcc
actcaggccaaggagctccgtcttgccagaattaccccgaccccctcccggaagctgccg
gagccctctgccctgtctgaggtcaccaaaccgcctccttgcttggagaactcctcgcct
ccctccaggattccggagcctgaatccccagcgaagccaaacgtccccgcagcctccaca
gcgcccccagcggactcccgggaccgacggaggtcctaccagatgcctgtgcgggatgag
gagtcggaatcccagagaaaagctcgctcccgtctcatgcgccagtctcggaggtccaca
cagggtgtgactctgacagacctgaaggaggcagagaagtctgcagggaaggccccggag
tcagagaagccggcgcagagcctggaccctttccggaggccccgcgtccctggagtggag
aactccgacagccctgcccggagagcagaggcgcctgacgggcagggtccaggaccgcag
gcggccagggagcaccgcaaggtcggaaaggagtggagggggcctgcggagggggaggag
gcggagccggctgatcgcagcccggagtccagcaccctggagggcggcccctcagcccgc
aggcagcggtcacagcgggacctcaacccagaacctgagccagaatcggaggagcaggat
ggaggctttaggaagctgtatgcagagctgcgcagggagaacgagcggcttcgcgaggct
ctgaccgagaccacgctgcggctggcgcagctcaaggtggaactggagcgggccacgcag
aggcaagagcgcttcgctgagagaccagcccttctggagctggagagattcgagcgcagg
gccctggaacgcaaggccgcagagctggaggaagagctgaaggccctgtctgacctccgc
gctgacaaccagcgcctcaaggatgagaatgcagcgttgatccgcgttatcagcaaactc
tccaagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675136
Entry
104675136         CDS       T03989                                 

Gene name
PPP1CC
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-gamma catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro03015  mRNA surveillance pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04114  Oocyte meiosis
rro04218  Cellular senescence
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04390  Hippo signaling pathway
rro04510  Focal adhesion
rro04611  Platelet activation
rro04720  Long-term potentiation
rro04728  Dopaminergic synapse
rro04750  Inflammatory mediator regulation of TRP channels
rro04810  Regulation of actin cytoskeleton
rro04910  Insulin signaling pathway
rro04921  Oxytocin signaling pathway
rro04931  Insulin resistance
rro05031  Amphetamine addiction
rro05034  Alcoholism
rro05168  Herpes simplex virus 1 infection
rro05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    104675136 (PPP1CC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    104675136 (PPP1CC)
   04024 cAMP signaling pathway
    104675136 (PPP1CC)
   04022 cGMP-PKG signaling pathway
    104675136 (PPP1CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104675136 (PPP1CC)
   04218 Cellular senescence
    104675136 (PPP1CC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104675136 (PPP1CC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104675136 (PPP1CC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104675136 (PPP1CC)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104675136 (PPP1CC)
   04921 Oxytocin signaling pathway
    104675136 (PPP1CC)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104675136 (PPP1CC)
   04270 Vascular smooth muscle contraction
    104675136 (PPP1CC)
  09156 Nervous system
   04728 Dopaminergic synapse
    104675136 (PPP1CC)
   04720 Long-term potentiation
    104675136 (PPP1CC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104675136 (PPP1CC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104675136 (PPP1CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    104675136 (PPP1CC)
   05034 Alcoholism
    104675136 (PPP1CC)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    104675136 (PPP1CC)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    104675136 (PPP1CC)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     104675136 (PPP1CC)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     104675136 (PPP1CC)
Transcription machinery [BR:rro03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     104675136 (PPP1CC)
Messenger RNA biogenesis [BR:rro03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     104675136 (PPP1CC)
Spliceosome [BR:rro03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    104675136 (PPP1CC)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 104675136
NCBI-ProteinID: XP_030795648
LinkDB
Position
10
AA seq 337 aa
MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRVASGLNPSIQKASNYRNNTVLYE
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcggatttagacaaactcaacatcgacagcatcatccaacggctgctggaagtgaga
gggtccaagcctggtaagaatgtccagcttcaggagaatgaaatcagaggactgtgttta
aaatctcgtgaaatctttctcagtcagcctatcctactagaacttgaagcaccactcaaa
atatgtggtgacatccatgggcaatactatgatttactgcgactttttgagtacggtggt
ttcccaccagaaagcaactacctgtttcttggggactatgtagacaggggaaagcagtca
ttggagacgatctgcctcttactggcctacaaaatcaaatatcctgagaatttttttctt
ctcagagggaaccatgaatgtgccagcatcaacagaatttatggattttatgatgaatgt
aaaagaagatacaacattaaactatggaaaactttcacagactgttttaactgtttaccg
atagcagccatcgtggatgagaagatattctgctgtcatggaggtttatcaccagatctt
caatctatggagcagattcggcgaattatgcgaccaactgatgtaccagatcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgac
agaggagtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaagatggatatgaattttttgcaaag
aggcagttggtcactctgttttctgcgcccaattattgtggagagtttgacaatgcaggt
gccatgatgagtgtggatgaaacactaatgtgttcttttcagattttaaagcctgcagag
aaaaagaagccaaatgccacgagacctgtaacgcctccaagggttgcatcaggcctgaac
ccgtccattcagaaagcttcaaattatagaaacaatactgttctatacgagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675773
Entry
104675773         CDS       T03989                                 

Gene name
PPP1R12A
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12A isoform X1
  KO
K06270  protein phosphatase 1 regulatory subunit 12A
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04270  Vascular smooth muscle contraction
rro04510  Focal adhesion
rro04611  Platelet activation
rro04810  Regulation of actin cytoskeleton
rro04921  Oxytocin signaling pathway
rro05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    104675773 (PPP1R12A)
   04022 cGMP-PKG signaling pathway
    104675773 (PPP1R12A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104675773 (PPP1R12A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104675773 (PPP1R12A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104675773 (PPP1R12A)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104675773 (PPP1R12A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104675773 (PPP1R12A)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104675773 (PPP1R12A)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104675773 (PPP1R12A)
SSDB
Motif
Pfam: Ank_2 Ank_4 PRKG1_interact Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 104675773
NCBI-ProteinID: XP_030795855
LinkDB
Position
10
AA seq 1030 aa
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLL
HRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLD
IAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRD
ARQWLNSGHINDVRHAKSGGTALHVAAAKGYTEVLKLLIQAGYDVNIKDYDGWTPLHAAA
HWGKEEACRILVDNLCDMEMVNKVGQTAFDVADEDILGYLEELQKKQNLLHSEKRDKKSP
LIESTANMDNNQSQKTFKNKETLIIEPEKNASRIESLEQEKVDEEEEGKKDESSCSSEED
EEDDSESEAETDKTKPLASITNANTSTTQAAPVAVTTPTVSSGQATPTSPIKKFPTTATK
ISPKEEERKDESPATWRLGLRKTGSYGALAEITASKEGQKEKDTAGVTRSASSPRLSSSL
DNKEKEKDSKGTRLAYVAPTIPRRLASTSDIEEKENRDSSSLRTSSSYTRRKWEDDLKKN
SSINEGSTYHKSCSFGRRQDDLISSSVPSTTSTPTVTSAAGLQKSLLSSTSTTTKITTGS
SSAGTQSSTSNRLWAEDSTEKEKDSVPTAVTIPVAPTVVNAAASTTTLTTTTAGTVSSTT
EVRERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVTLTDLQEAEKTIGRNRPTRTR
EQENEEKEKEEKEKQDKEKQEEKKESETSREDEYKQKYSRTYDETYQRYRPVSASSSATP
SSSLSTMSSSLSPSSQLNRPNSLVGITSVYPRGITKENEREGEKREEEKEGEDKSQSKSI
RERRRPREKRRSTGVSFWTQDSDENEQEQQSDAEEGSNKKETQTDSISRYETSSTSAGDR
YDSLLGRSGSYSYLEERKPYSGRLEKDDSTDFKKLYEQILAENEKLKAQLHDTNMELTDL
KLQLEKATQRQERFADRSLLEMEKRERRALERRISEMEEELKMLPDLKADNQRLKDENGA
LIRVISKLSK
NT seq 3093 nt   +upstreamnt  +downstreamnt
atgaagatggcggacgcaaagcagaagcggaacgagcagctgaagcgctggatcggctcc
gagacggaccttgagccaccggtggtgaagcgccagaagaccaaggtgaagttcgacgat
ggcgccgtcttcctggctgcttgctccagcggggacacggacgaggtcctcaagctgctg
caccgcggcgccgacatcaattacgccaatgtggacggactcactgccctgcaccaggct
tgcattgatgacaatgttgatatggtgaagtttctggtagaaaatggagcaaatattaat
caacctgataatgaaggctggataccactacatgcagcagcttcctgtggatatcttgat
attgcagagtttttgattggtcagggagcacatgtaggggctgtcaacagtgaaggagac
acacctttagatattgcggaggaggaggcaatggaagagctacttcaaaatgaagttaat
cggcaaggggttgatatagaagcagctcgaaaggaagaagaacggatcatgcttagagat
gccaggcagtggctaaatagtggtcatataaatgatgtccggcatgcaaaatctggaggt
acagcactccacgttgcagctgctaaaggctatacggaagttttaaaacttttaatacag
gcaggctatgatgttaatattaaagactatgatggctggacacctcttcatgctgcagct
cattggggtaaagaagaagcatgtcgaattttagtggacaatctatgtgatatggagatg
gtcaacaaagtgggccaaacagcctttgatgtagcagatgaagacattttaggatattta
gaagagttgcaaaagaaacaaaatctgctccatagtgaaaaacgggacaagaaatctcca
ctaattgaatcaacagcaaatatggacaataatcagtcacagaagacctttaaaaacaaa
gagacattgattattgaaccagagaaaaatgcatcccgtattgaatctctggaacaagaa
aaggttgatgaagaagaagaaggaaagaaagatgagtctagctgctctagtgaagaagat
gaggaagatgactcggaatcagaagctgaaacagataagacaaaacccctggcttctata
actaatgccaacacttctactacacaagcagctcctgtagctgttacaacacctactgtg
tcatcaggtcaagcaacacctacatcacctattaaaaagtttccaaccacagctacaaaa
atttctcccaaagaagaagagagaaaagatgagtctcctgcaacttggaggttaggactt
agaaagacgggcagctatggtgcacttgctgaaatcacagcatctaaagagggtcagaaa
gaaaaagatactgcaggtgttacacgttcagcttcaagtcccagactttcctcctctttg
gataataaagaaaaggagaaagatagtaaaggaactaggcttgcatatgttgcacctaca
ataccaagacgactagccagtacatctgacattgaagagaaagaaaacagagattcttca
agtttgcgaacaagtagttcatatacaaggagaaaatgggaagatgatcttaaaaaaaat
agctcaattaatgaaggatcaacttatcataaaagttgctcctttggtagaagacaagat
gatttgattagttctagtgttccaagcaccacatcaacaccaacagttacctctgcagct
gggcttcagaaaagcctgctttccagcacaagcactactacaaagattacaacgggttct
tcctcagcaggcacacaaagcagtacctcaaatcgtttgtgggctgaggatagtactgaa
aaagaaaaggacagtgttcctacggcagtgaccattcctgttgctccaactgttgtaaat
gctgcagcttctaccacaaccctgactacaactactgctggcactgtctcctccacaaca
gaggtcagggagagacgcagatcatacctcactcctgttagggatgaagagtctgaatcc
caaagaaaagcaagatctagacaagcaagacaatctagaagatcaacacagggagtgaca
ttaactgatcttcaagaagctgagaaaacaataggaagaaatcgtcctacccgaaccaga
gaacaagaaaatgaagaaaaagaaaaagaggaaaaagaaaaacaagataaagagaaacaa
gaagaaaagaaggagtcagaaacatctagagaagacgaatataaacaaaaatactccaga
acgtatgatgagacttaccagcgttataggccagtatcagcttcaagttcagccactcca
tcctcttcactttctactatgagcagttcactctctccttcaagtcaactaaacaggcca
aatagtcttgtaggcataacttctgtttaccccagaggaataacaaaagaaaatgaaaga
gagggagaaaaaagagaagaggaaaaagaaggagaagataaatcacaatctaaatcaatt
agagaacgacggcgaccaagagagaaaagaagatctacaggagtttcattttggacacaa
gatagtgatgaaaatgaacaagaacaacaatcagatgcagaagagggatccaataagaaa
gaaactcagacggattccatttctagatatgaaaccagttctacatcagctggtgatcga
tatgattccttgctgggtcgctctggatcatacagttacttggaagaaagaaaaccttat
agcggcaggctagaaaaggatgactcaactgactttaaaaagctttatgaacaaattcta
gctgaaaatgaaaagctgaaggcacagctacatgatacaaatatggaactaacagatctt
aaattacagttggaaaaggccacccagagacaagaaagatttgctgataggtcactgttg
gaaatggagaaaagggaacgaagagctctagaaagaagaatatctgaaatggaagaagag
ctcaaaatgttaccagacctaaaagcagacaaccagaggctaaaggatgaaaatggggcc
ttgatcagagttataagcaaactttccaaataa

DBGET integrated database retrieval system