KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664872
Entry
104664872         CDS       T03989                                 

Definition
(RefSeq) myosin-7
  KO
K17751  myosin heavy chain 6/7
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04022  cGMP-PKG signaling pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro04919  Thyroid hormone signaling pathway
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    104664872
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    104664872
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104664872
   04261 Adrenergic signaling in cardiomyocytes
    104664872
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104664872
   05414 Dilated cardiomyopathy
    104664872
   05416 Viral myocarditis
    104664872
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rro04812]
    104664872
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     104664872
SSDB
Motif
Pfam: Myosin_head Myosin_tail_1 Myosin_N Crescentin IQ AAA_22 Filament
Other DBs
NCBI-GeneID: 104664872
NCBI-ProteinID: XP_030786091
LinkDB
Position
5
AA seq 1935 aa
MGDSEMAAFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKEEFVKAKILSREGGKVT
AETENGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRYSSWMIYTYSGL
FCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES
GAGKTVNTKRVIQYFAVIAAIGDRSKKDQNTGKGTLEDQIIEANPALEAFGNAKTVRNDN
SSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDM
LLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTTEEKNSMYKLTGAIMHFG
NMKFKQKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQV
AYATGALAKAVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINF
TNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMF
PKATDMTFKAKLFDNHLGKSSNFQKPRNIKGKPEAHFSLIHYAGTVDYNIIGWLQKNKDP
LNETVVGLYQKSSLKLLSSLFANYAGADAPIEKGKGKAKKGSSFQTVSALHRENLNKLMT
NLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQ
RYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDER
LSRIITRIQAQSRGVLSRMEYKKLLERRDSLLIIQWNIRAFMGVKNWPWMKLYFKIKPLL
KSAETEKEMATMKEEFARLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLAD
AEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELT
LAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTL
TKAKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERL
KKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLS
RELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSV
AELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHR
SKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLE
EEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAI
QRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAA
ALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKR
ENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEKLELQSALEEAEASLEHEEGKILR
AQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEG
DLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNL
LQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTE
VEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEA
EQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKN
LLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKL
RAKSRDIGTKGLNEE
NT seq 5808 nt   +upstreamnt  +downstreamnt
atgggagattcggagatggccgcctttggggctgccgccccctacctgcgcaagtcagag
aaggagcggctagaagcccagaccaggccttttgacctcaagaaggatgtcttcgtgcct
gatgacaaagaggagttcgtcaaggccaagatcctgtctcgagagggtggcaaagtcact
gccgagaccgagaatggcaagacagtgactgtgaaggaggatcaggtgatgcagcagaac
ccacccaagttcgacaaaattgaggacatggccatgctgaccttcctgcacgagcccgcg
gtgctctacaacctcaaggatcgctacagctcctggatgatctatacctactcgggcctc
ttctgtgtcaccgtcaacccctacaagtggctgccagtgtacaacgccgaggtggtggct
gcctaccggggcaagaagaggagcgaggccccaccccacatcttctccatctccgacaat
gcctatcagtacatgctgacagacagagaaaaccagtccatcctgatcaccggagaatcc
ggagcagggaagacggtcaacaccaagagggtcatccagtattttgctgttattgcagcc
attggggaccgcagcaagaaggaccagaacacgggcaagggcaccctggaggaccagatc
atcgaggccaaccctgctctggaggcctttggcaatgccaagactgtccggaatgataac
tcctcccgctttgggaaattcattcgaatccattttggggcaacaggaaagttggcatct
gcagacatagagacctatcttctggaaaaatccagagttattttccagctgaaagcagag
agagattatcacattttctaccaaatcctgtctaacaaaaagcctgagctgctggacatg
ctgctgatcaccaacaacccctatgattatgcattcatctcccaaggagagaccactgtg
gcctccattgatgacgctgaggagctcatggccactgataatgcctttgacgtgctgggc
ttcactacagaggagaaaaactccatgtacaagctgacaggcgccatcatgcactttgga
aacatgaagttcaagcagaagcagcgggaggagcaggcagagccggacggcactgaagag
gctgacaagtctgcctacctcatggggctgaactcagccgacctgcttaaggggttgtgc
catcctcgggtgaaagtgggcaatgagtatgtcaccaaggggcagaatgtccagcaggtg
gcatatgccactggggcactggccaaggcagtgtacgagaagatgttcaactggatggtg
acacgcatcaacgccaccctggagaccaagcagccacgccagtacttcataggagtcctg
gacatcgctggctttgagatctttgatttcaacagctttgagcagctctgcatcaacttc
accaacgagaagctgcagcagttcttcaaccaccacatgttcgtgctggagcaggaggaa
tacaagaaggagggcatcgagtggacattcattgactttggcatggacctgcaggcctgc
atcgacctcatcgagaagcccatgggcatcatgtccatcctggaggaggagtgcatgttc
cccaaggccaccgacatgaccttcaaggccaagctgtttgacaaccacctgggcaaatcc
tccaacttccagaagccacgcaatatcaaggggaagcctgaagcccacttctccctgatc
cactatgctggcaccgtggactacaacatcattggttggctgcagaagaacaaggaccct
ctcaatgagactgtagtgggcttgtatcagaagtcctccctcaagctgctcagctccctg
tttgccaactatgctggagctgatgcgcctattgagaagggaaaaggcaaggccaagaaa
ggctcgtcctttcagactgtgtcagctctgcacagggaaaatctgaacaagctgatgacc
aacttgcgctccacccatcctcactttgtacgttgcatcatccccaatgagacaaagtct
ccaggggtgatggacaaccccctggtcatgcaccagctgcgctgcaatggcgtgctggaa
ggcatccgcatctgtaggaagggcttccccaaccgcatcctctacggggacttccggcag
aggtatcgcatcctcaacccagcggccatccctgagggacagttcattgacagcaggaag
ggggcagagaagctgctcggctccctggacattgaccacaaccagtacaagtttggccac
accaaggtgttcttcaaggccgggctgctgggactgctggaggagatgagggatgagagg
ctgagccgcatcatcacgcgtatccaggcccagtcccggggtgtactttccagaatggag
tacaaaaagcttctggaacgtagagactccctgctgataatccagtggaacattcgagcc
ttcatgggggtcaagaattggccctggatgaagctctacttcaagatcaagccgctgctg
aagagcgcagagacggagaaggagatggccaccatgaaggaggagtttgcacgcctcaaa
gaggcactggagaagtccgaggctcgccgcaaggagctggaagagaagatggtgtccctg
ctgcaggagaagaatgacctgcagctccaagtgcaggcggaacaagataacctggcagat
gctgaggagcgctgtgatcagctgatcaaaaacaagattcagctggaggccaaggtgaag
gagatgaatgagaggctggaggatgaggaggagatgaatgctgagctcactgccaagaag
cgcaagctggaagatgagtgctcagagctcaaaagggacatcgatgatctggagctgaca
ctggccaaagtggagaaggagaaacacgcaacagagaacaaggtgaaaaacctgacagag
gagatggctgggctggatgagatcattgctaagctgaccaaggagaaaaaagctctgcaa
gaggcccaccagcaggccctggatgaccttcaggccgaggaggacaaggtcaacaccctg
actaaggccaaagtcaagctggagcagcaagtggatgatctggagggatccctagaacaa
gagaagaaggtgcgcatggacctggagcgagcgaagcggaagttggagggcgacctgaag
ctgacccaggagagcatcatggacctggagaatgacaagcagcagctggatgagcgactg
aaaaagaaagactttgagttgaatgctctcaatgcaagaattgaggatgaacaggccctt
ggcagccagctgcagaagaagctcaaggagcttcaggcgcgcatcgaggagctagaggag
gagctggaggcggagcgcaccgctagggctaaggtggagaagctgcgctcagacctgtcc
cgggagctggaggagatcagcgagcggctggaagaagccggcggggccacgtcagtgcag
atcgagatgaacaagaagcgcgaggccgagttccagaagatgcggcgggacctggaggag
gccacgctgcagcacgaggccacggccgccgctctgcgcaagaagcacgccgacagcgtg
gcagagctgggcgagcagatcgacaacctgcagcgggtgaagcagaagctggagaaggag
aagagcgagttcaagctggagctggacgacgtcacctccaacatggagcagatcattaag
gccaaggctaacctggagaagatgtgcaggaccttggaagaccagatgaatgagcatcgt
agcaaggcggaggagacccagcgttctgtcaatgacctcaccagccagcgggccaagctg
caaacggagaatggtgagctgtcccggcagctggatgaaaaggaggcactgatctcccag
ctgacccgaggcaagctcacctacacccagcagctggaggacctcaagaggcagctggag
gaggaggttaaggcgaagaacgccctggcccacgcactgcagtcagcccggcatgactgt
gacctgctgcgggagcagtacgaggaggagacagaggccaaggctgagctgcagcgcgtc
ctgtccaaggccaactcggaggtggcccagtggaggaccaagtatgagacagatgccatc
cagcggactgaggagcttgaggaggccaagaagaagctggcccagcggctgcaggatgcc
gaggaggccgtggaggctgttaatgccaagtgctcctcactggagaagaccaagcaccgg
ctacagaatgagattgaggacctgatggtggacgtggagcgctccaatgctgctgctgca
gccctggacaagaagcagaggaacttcgacaagatcctggccgagtggaagcagaagtat
gaggagtcgcagtcggagctggagtcctcacagaaggaggctcgctccctcagcacagag
ctcttcaagctcaagaacgcctatgaggagtccctggagcatctggagaccttcaagcgg
gagaacaagaaccttcaggaggagatctccgacttgactgagcagttgggttccagcgga
aagactatccacgagctggagaaggtccgaaagcagctggaggccgagaagctggagctg
cagtcagccctggaggaggccgaggcctccctggagcacgaggagggcaagatcctccgg
gcccagctagagttcaaccagatcaaggcagagatcgagcggaagctggcagagaaggac
gaggagatggaacaggccaagcgcaaccacctgcgggtggtggactcgctgcagacctcc
ctggatgcagagacacgcagccgcaatgaggccctgagggtgaagaagaagatggaagga
gacctcaatgagatggagatccagctcagccacgccaaccgcatggccgccgaggcccag
aagcaagtcaagagcctccagagcttgttgaaggacacccagattcagctggacgacgca
gtccgcgccaacgacgacctaaaggagaacatcgccattgtggagcggcgcaacaacctg
ctgcaggctgagctggaggagttgcgtgccgtggtagagcagacagagcggtctcggaag
ctggcagagcaggagctgattgagaccagcgagcgggtgcagctgctgcattcccagaac
accagcctcatcaaccagaagaagaagatggatgctgacctgtcccaactgcagactgaa
gtggaggaggcagtacaggagtgcaggaacgccgaggagaaagccaagaaagccatcaca
gatgctgccatgatggcagaggagctgaagaaggagcaggacaccagcgctcacctggag
cgcatgaagaagaacatggagcagaccattaaggacctgcagcaccggctggacgaagcc
gagcagatcgccctcaagggcggcaagaagcagctgcagaagctggaagcgcgggtgcgg
gagctggagaatgagctggaggcagagcagaaacgcaatgcggagtcggtgaagggcatg
aggaagagcgagcggcgcatcaaggagctcacctaccagacggaggaggacaggaaaaac
ctgctgcggctgcaggacctggtagacaagctgcagctaaaggtcaaggcctacaagcgc
caggccgaggaggcggaggagcaagccaacaccaacctgtccaagttccgcaaggtgcag
cacgagctggatgaggcggaggagcgggcggacattgccgagtcccaggtcaacaagctg
agggccaagagccgtgacattggcaccaagggcttgaatgaggagtag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674161
Entry
104674161         CDS       T03989                                 

Definition
(RefSeq) myosin-6
  KO
K17751  myosin heavy chain 6/7
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04022  cGMP-PKG signaling pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro04919  Thyroid hormone signaling pathway
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    104674161
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    104674161
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104674161
   04261 Adrenergic signaling in cardiomyocytes
    104674161
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104674161
   05414 Dilated cardiomyopathy
    104674161
   05416 Viral myocarditis
    104674161
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rro04812]
    104674161
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     104674161
SSDB
Motif
Pfam: Myosin_head Myosin_tail_1 Myosin_N Crescentin AAA_22 AAA_16
Other DBs
NCBI-GeneID: 104674161
NCBI-ProteinID: XP_010376719
UniProt: A0A2K6PEE1
LinkDB
Position
5
AA seq 1939 aa
MTDAQMADFGAAAQYLRKSEKERLEAQTRPFDIRTECFVPDDKEEFVKAKIVSREGGKVT
AETENGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLFNLKERYAAWMIYTYSGL
FCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES
GAGKTVNTKRVIQYFASIAAIGDRGKKDNANANKGTLEDQIIQANPALEAFGNAKTVRND
NSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLD
MLLVTNNPYDYAFVSQGEVSVASIDDSEELMATDSAFDVLGFTSEEKAGVYKLTGAIMHY
GNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQ
VYYSIGALAKAVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCIN
FTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECM
FPKATDMTFKAKLYDNHLGKSNNFQKPRNIKGKQEAHFSLIHYAGTVDYNILGWLEKNKD
PLNETVVALYQKSSLKLMATLFSSYASADVGDSGKSKGGKKKGSSFQTVSALHRENLNKL
MTNLRTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDF
RQRYRILNPAAIPEGQFIDSRKGSEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRD
ERLSRIITRMQAQARGQLMRIEFKKIVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKP
LLKSAETEKEMATMKEEFGRIKETLEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNL
NDAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLE
LTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQVEEDKVN
TLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEE
KLKKKEFEINQQNSKIEDEQALALQLQKKLKENQARIEELEEELEAERTTRAKVEKLRSD
LSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATATALRKKHAD
SVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANE
YRVKLEEAQRSLNDFTTQRAKLQTENGELARQLEEKEALISQLTRGKLSYTQQMEDLKRQ
LEEEGKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETD
AIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAA
AAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETF
KRENKNLQEEISDLTEQLGEGGKNVHELEKVRKQLEVEKLELQSALEEAEASLEHEEGKI
LRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHQRVVDSLQTSLDAEARSRNEALRVKKKM
EGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRN
NLLQAELEELRAMVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQ
SEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLD
EAEQIALKGGKKQLQKLEARVRELENELEAEQKRNSESVKGMRKSERRIKELTYQTEEDK
KNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVN
KLRAKSRDIGAKQKMHDEE
NT seq 5820 nt   +upstreamnt  +downstreamnt
atgactgatgcccagatggctgactttggggcagcggcccagtacctccgcaagtcagag
aaggagcgtctagaggcccagacccggccctttgacattcgcactgagtgcttcgtgcca
gacgacaaggaagagtttgtcaaagccaagattgtgtcccgggaggggggcaaggtcact
gctgaaaccgagaatgggaagacggtgactgtgaaggaggaccaggtgttgcagcagaac
ccacccaagttcgataagatcgaggacatggccatgctgaccttcctgcacgagcccgca
gtgcttttcaacctcaaagagcgctacgcagcctggatgatatatacctactcgggcctc
ttctgtgtcaccgtcaacccctacaagtggctgccggtgtacaatgctgaggtggtggcc
gcctaccggggcaagaagaggagtgaggccccgccccacatcttctccatctctgacaac
gcctatcagtacatgctgacggatcgggagaaccagtccatcctcatcacgggagaatcc
ggggcggggaagactgtgaacaccaagcgtgtcatccagtactttgccagcattgcagcc
ataggtgaccgtggcaagaaggacaatgccaatgcgaacaagggcacactggaggaccag
atcatccaggccaaccccgctctggaggccttcggcaacgccaagactgtccggaacgac
aactcctcccgcttcgggaaattcattaggatccactttggggccactggaaaactggct
tctgcggacatagagacctacctgctggagaagtcccgggtgatcttccagctgaaagct
gagagaaactaccacatcttctaccagattctgtccaacaagaagccagagttgctggac
atgctgctggtcaccaacaacccctacgactatgccttcgtgtctcagggagaggtgtct
gtggcctccatcgatgactccgaggagctcatggccaccgatagtgcctttgacgtgctg
ggcttcacttcagaggagaaagctggcgtctacaagctgacgggagccatcatgcactac
gggaacatgaagttcaagcagaagcagcgggaggagcaggcagagccagacggcactgaa
gatgctgacaagtcggcctacctcatggggctgaactcagccgacctcctcaaagggctg
tgccaccctcgggtgaaagtgggcaacgagtacgtcaccaaggggcagagcgtgcagcag
gtgtactactccatcggggcactggccaaggcagtgtatgagaagatgttcaactggatg
gtgacacgcatcaacgccaccctggagaccaagcagccacgccagtacttcataggagtc
ctggacatcgctggcttcgagatctttgatttcaacagctttgagcagctctgcatcaac
ttcaccaacgagaagctgcagcagttcttcaaccaccacatgttcgtgctggagcaggag
gaatacaagaaggagggcatcgagtggacattcattgactttggcatggacctgcaggcc
tgcatcgacctcatcgagaagcccatgggcatcatgtccatcctggaggaggagtgcatg
ttccccaaggccaccgacatgactttcaaggccaagctgtacgacaaccacttaggcaag
tccaacaatttccagaagccacgcaacatcaaggggaagcaggaagcccacttctccctg
atccattatgccggcaccgtggactacaacatcctgggctggctggaaaaaaacaaggat
cctctcaacgagactgttgtggccctgtaccagaagtcctccctcaagctcatggccact
ctcttctcctcctatgcatctgccgatgttggggacagtggtaaaagcaaaggaggcaag
aaaaagggctcatccttccagacggtgtcagctctccaccgggaaaatctgaacaagctg
atgaccaacctgaggaccacccatcctcactttgtgcgttgcatcatccccaatgagcgg
aaggctccaggggtgatggacaatcctttggttatgcaccagctgcgctgcaatggcgtg
ctggagggcattcgcatctgcaggaagggcttccccaaccgcatcctctacggggatttc
cggcagaggtatcgcatcttgaacccagcggccatccctgagggacagttcattgacagc
aggaagggatcagagaagctgctcagctccctggacattgaccacaaccagtacaagttt
ggccacaccaaggtgttcttcaaagcagggctgctggggctgctggaggagatgcgggat
gagagactgagccgcatcatcacacgcatgcaggcccaagcccggggccagctcatgcgc
attgagtttaagaagatagtggaacgcagggatgccctgttggtaatccagtggaacatt
cgggccttcatgggggttaagaattggccctggatgaagctctacttcaagatcaagccg
ctgctgaagagcgcagagacagagaaggagatggccaccatgaaggaggagttcgggcgc
atcaaagagacactggagaagtccgaggctcgccgcaaggagctggaggagaagatggtg
tccctgctgcaggagaagaacgacctgcagctccaagtgcaggcggaacaagacaacctc
aatgatgctgaggagcgctgcgaccagctgatcaaaaacaagattcagctggaggccaaa
gtgaaggagatgaatgagagactggaggacgaggaggagatgaacgcggagctcactgcc
aagaagcgcaagctggaagacgagtgctcggaactcaagaaggacatcgatgacctggag
ctgacactggccaaggtggagaaggagaagcatgcaacagagaacaaggtgaagaaccta
acagaggagatggctgggctagatgagatcatcgctaagctgaccaaggagaagaaagct
ctacaagaggcccatcagcaggccctggatgaccttcaggttgaggaggacaaggtcaac
accctgtccaagtctaaggtcaagctggagcagcaggtggatgacctggagggatccctg
gagcaagagaagaaggtgcgcatggacctggagcgagcgaagcggaaactggagggcgac
ctgaagctgacacaggagagcatcatggacctggaaaatgataaactgcagctggaagaa
aagctcaagaagaaggagtttgaaattaatcagcagaacagtaagattgaggatgagcag
gcactggcccttcagctacagaagaaactgaaggaaaatcaggcgcgcatcgaggagctg
gaggaggaactggaggcggagcgcaccaccagggctaaggtggagaagctgcgctcagac
ctgtcccgggagctggaggagatcagcgagcggctggaagaagccggcggggccacgtca
gtgcagatcgagatgaacaagaagcgcgaggccgagttccagaagatgcggcgggacctg
gaggaggccacgctgcagcacgaggccacggccaccgccctgcgcaagaagcacgccgac
agcgtggcagagctgggcgagcagatcgacaacctgcagcgggtgaagcagaagctggag
aaggagaagagcgagttcaagctggagctggacgacgtcacctccaacatggagcagatc
atcaaggccaaggcaaacctggagaaagtttctcggacgctggaggaccaggccaacgag
taccgcgtgaagctagaagaggcccaacgctccctgaacgacttcaccacccagcgagcc
aagctgcagactgagaatggagagttggcccggcagctagaggaaaaggaggcgctaatc
tcgcagctgacccgggggaagctctcctatacccaacaaatggaggacctcaaaaggcag
ctggaggaggagggcaaggcaaagaacgccctggcccatgcactgcagtcggcccggcat
gactgcgacctgctgcgggagcaatacgaggaggagacggaggccaaggctgagctgcag
cgcgtcctgtccaaggccaactcagaggtggcccagtggaggaccaagtatgagacggac
gctatccaacggaccgaggagctcgaggaagccaaaaagaagctggcccagcggctgcag
gatgccgaggaggccgtggaggctgttaatgccaagtgctcctcgctggagaagaccaag
caccggctacagaatgagattgaggacctgatggtggacgtggagcgctccaatgctgct
gctgcagccctggacaagaagcagaggaacttcgacaagatcctggccgagtggaagcag
aagtatgaggagtcgcagtcggagctggagtcctcgcagaaggaggctcgctccctcagc
acagagctctttaagctcaagaacgcctatgaggagtccctggagcacctggagaccttc
aagagggagaacaagaaccttcaggaggaaatctcggaccttactgagcagctaggagaa
ggaggaaagaatgtgcatgagctggagaaggtccgcaaacagctggaggtcgagaagctg
gagctgcagtcagccctggaggaggcagaggcctccctggagcatgaggagggcaagatc
ctccgggcccagttagagttcaaccagatcaaggcagagatcgagcggaagctggcagag
aaggacgaggagatggaacaggccaagcgcaatcaccagcgggtggtggactcgctgcag
acttccctggacgcagaggcacgcagccgcaacgaggccctgagggtgaagaagaagatg
gaaggagacctcaatgagatggagatccagctcagccacgccaaccgcatggccgccgag
gcccagaagcaagtcaagagcttgcagagcttgctgaaggacacccagatccagctggat
gacgcagtccgcgccaacgacgatctaaaggagaacatcgccattgtggagcggcgcaac
aacctgctgcaggctgagctggaggagctgcgtgccatggtggagcagacagagcggtct
cggaagctggcagagcaggagctgattgagaccagcgagcgggtgcagctgctgcattcc
cagaacaccagcctcatcaaccagaagaagaagatggagtcagacctgacccaactccag
tcggaagtggaggaggcggtacaggagtgcaggaatgccgaggagaaggccaagaaggcc
atcacggatgccgccatgatggcagaggagctgaagaaggagcaggacaccagcgcccac
ctggagcgcatgaagaagaacatggagcagactattaaagacctgcagcaccggctggac
gaggcggagcagatcgccctcaagggcggcaagaagcagctgcagaagctagaagcgcga
gtgcgggagctggagaatgagctggaggccgagcagaagcgcaactcagagtcggtgaag
ggcatgaggaagagcgagcggcgcatcaaggagctcacctaccagacagaggaagacaaa
aagaacctgctgcggctgcaggacctggtggacaagctgcaactgaaggtcaaggcctac
aagcgccaggccgaggaggcggaggagcaagccaacaccaacctgtccaagttccgcaag
gtgcagcacgagctggatgaggcagaggagcgggcagacattgctgagtcccaggtcaac
aaacttcgagccaagagccgagacattggcgccaagcaaaaaatgcatgacgaggagtga

DBGET integrated database retrieval system