KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664964
Entry
104664964         CDS       T03989                                 

Gene name
GNA12
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-12
  KO
K04346  guanine nucleotide-binding protein subunit alpha-12
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04270  Vascular smooth muscle contraction
rro04730  Long-term depression
rro04810  Regulation of actin cytoskeleton
rro04928  Parathyroid hormone synthesis, secretion and action
rro05163  Human cytomegalovirus infection
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104664964 (GNA12)
   04072 Phospholipase D signaling pathway
    104664964 (GNA12)
   04071 Sphingolipid signaling pathway
    104664964 (GNA12)
   04022 cGMP-PKG signaling pathway
    104664964 (GNA12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104664964 (GNA12)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    104664964 (GNA12)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104664964 (GNA12)
  09156 Nervous system
   04730 Long-term depression
    104664964 (GNA12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104664964 (GNA12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104664964 (GNA12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104664964 (GNA12)
   04031 GTP-binding proteins [BR:rro04031]
    104664964 (GNA12)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   104664964 (GNA12)
GTP-binding proteins [BR:rro04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    104664964 (GNA12)
SSDB
Motif
Pfam: G-alpha Arf GTP_EFTU FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 104664964
NCBI-ProteinID: XP_010364973
LinkDB
Position
6
AA seq 381 aa
MSGVVRTLSRCLLPAEAGGARERRAGGGARDAEREARRRSRDIDALLARERRAVRRLVKI
LLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQ
YSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESVK
YFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQ
CFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMDL
LVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENVR
FVFHAVKDTILQENLKDIMLQ
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgtccggggtggtgcggaccctcagccgctgcctgctgccggccgaggccggcggggcc
cgcgagcgcagggcgggcggcggcgcgcgcgacgcggagcgcgaggcccggagacgcagc
cgcgacatcgacgcgctgctggcgcgcgagcggcgcgcggtccggcgcctggtgaagatc
ctgctgctgggcgcgggcgagagcggcaagtccacgttccttaaacagatgcgcatcatc
cacggccgcgagtttgaccagaaggcgctgctggaattccgcgacaccatcttcgacaac
atcctcaagggctcaagggttcttgttgatgcacgagataagcttggcattccttggcag
tattctgaaaatgagaagcatgggatgttcctgatggccttcgagaacaaggcggggctg
cctgtggagcctgccaccttccagctgtacgtcccggccctgagcgcactctggagggat
tctggcatcagggaggctttcagccggaggagcgagtttcagctgggggaatcagtgaag
tacttcctggacaacttggaccggatcggccagctgaattactttcctagtaagcaagac
atcctgctggcgaggaaagccaccaagggaattgtggagcatgacttcgttattaagaag
atcccatttaagatggtggatgtgggcggccagcggtcccagcgccagaagtggttccag
tgctttgacgggatcacgtccatcctgttcatggtctcctccagcgagtacgaccaggtc
ctcatggaggacaggcgcaccaaccggctggtggagtccatgaacatcttcgagaccatc
gtcaacaacaagctcttcttcaacgtctccatcattctcttcctcaacaagatggacctc
ctggtggagaaggtgaagacggtgagcatcaagaagcacttcccggacttcaggggcgac
ccgcacaggctagaggacgtccagcgctacctggtccagtgcttcgacaggaagagacgg
aaccgcagcaagccgctgttccaccacttcaccaccgccatcgacaccgagaacgtccgc
ttcgtgttccatgctgtgaaagacaccatcctgcaggagaacctgaaggacatcatgctg
cagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675436
Entry
104675436         CDS       T03989                                 

Gene name
GNA13
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04022  cGMP-PKG signaling pathway
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04270  Vascular smooth muscle contraction
rro04371  Apelin signaling pathway
rro04611  Platelet activation
rro04730  Long-term depression
rro04810  Regulation of actin cytoskeleton
rro04928  Parathyroid hormone synthesis, secretion and action
rro05163  Human cytomegalovirus infection
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104675436 (GNA13)
   04072 Phospholipase D signaling pathway
    104675436 (GNA13)
   04071 Sphingolipid signaling pathway
    104675436 (GNA13)
   04022 cGMP-PKG signaling pathway
    104675436 (GNA13)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104675436 (GNA13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104675436 (GNA13)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    104675436 (GNA13)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104675436 (GNA13)
  09156 Nervous system
   04730 Long-term depression
    104675436 (GNA13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104675436 (GNA13)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104675436 (GNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104675436 (GNA13)
   04031 GTP-binding proteins [BR:rro04031]
    104675436 (GNA13)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104675436 (GNA13)
  Exosomal proteins of colorectal cancer cells
   104675436 (GNA13)
GTP-binding proteins [BR:rro04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    104675436 (GNA13)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 104675436
NCBI-ProteinID: XP_030778866
LinkDB
Position
19
AA seq 377 aa
MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGD
KMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFLDN
LDKLGEPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSV
TSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV
QIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcggacttcctgccgtcgcggtccgtgctgtccgtgtgcttccccggctgcttgcta
acgagcggcgaggccgagcagcaacgcaagtccaaggagatcgacaaatgcctgtctcgg
gaaaagacttacgtgaagcggctggtgaagatccttctgctgggcgcaggcgagagcggc
aagtccaccttcctgaagcagatgcggatcatccacgggcaggatttcgaccagcgcgcg
cgcgaggagttccgccccaccatctacagcaacgtgatcaaaggtatgagggtgctggtt
gatgctcgagagaagcttcatattccctggggagataattcaaaccaacaacatggagat
aagatgatgtcatttgatacccgggcccccatggcagcccaaggaatggtggaaacaagg
gttttcttacaatatcttcctgctataagagcattatgggcagacagcggcatacagaat
gcctatgaccggcgtcgagaatttcagctgggtgaatctgtaaaatatttcctggataac
ttggataaacttggagagccagattatattccatcacaacaagatattctgcttgccaga
agacccaccaaaggcattcatgaatatgactttgaaattaaaaatgttcctttcaaaatg
gttgatgtaggtggtcagagatcagaaaggaaacgttggtttgagtgtttcgacagtgtc
acatcaatacttttccttgtttcctcaagtgaatttgaccaggtgcttatggaagatcga
ctgaccaatcgccttacagagtctctgaacatttttgaaacaattgtcaataaccgggtt
ttcagcaatgtctccataattctgttcttaaacaagacagacttgcttgaggagaaggtg
caaattgtgagcatcaaagactatttcctagaatttgaaggggatccccactgcttaaga
gacgtccaaaaattcctggtggaatgtttccggaacaaacgccgggaccagcagcagaag
cccttataccaccacttcaccactgctatcaatacggagaacatccgccttgttttccgg
gatgtgaaggatactattctgcatgacaacctcaagcagcttatgctacagtga

DBGET integrated database retrieval system