KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104665167Help
Entry
104665167         CDS       T03989                                 

Gene name
CHRNA10
Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-10
  KO
K04811  nicotinic acetylcholine receptor alpha-10
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104665167 (CHRNA10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104665167 (CHRNA10)
Ion channels [BR:rro04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   104665167 (CHRNA10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 104665167
NCBI-ProteinID: XP_010365234
UniProt: A0A2K6RGN5
LinkDB All DBs
Position
15
AA seq 450 aa AA seqDB search
MGLRSHHLSLGLLLLFLLPAECLGAEGRLALKLFRDLFANYTSALRPVADTDQTLNVTLE
VTLSQIIDMDERNQVLTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYN
KADAQQPGSASTNVVLRHDGAVRWDAPAITRSSCRVDVAAFPFDAQRCGLTFGSWTHGGH
QLDVRPRGAAASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLHRRAAAYV
CNLLLPCVLISLLAPLAFHLPADSGEKVSLGITVLLALTVFQLLLAESMPPAESVPLIGK
YYMATMTMVTFSTALTILIMNLHYCGPSARPVPAWARALLLGHLAQSLCVQERGEPCGQS
RPPELSPSPQSPEGEAGPPAGPCHEPRCLCRQEALLHHVATIANTFRSHRAAQRCHEDWK
RLARVMDRFFLGIFFSMALVMSLLVLVQAL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggggctccggagccaccacctcagcctgggccttctgcttctgtttctactccctgca
gagtgcctgggagctgagggccggctggctctaaagctgttccgtgacctcttcgccaac
tacacaagtgccctgagacctgtggcagacacagaccagactctgaatgtgaccctggaa
gtgacactgtcccagatcatcgacatggatgaacggaaccaggtgctgaccctgtatctg
tggatacggcaggagtggacagatgcctacctacgatgggaccccaatgcctatggcggc
ctggatgccatccgcatccccagcagtcttgtgtggcggccagacatcgtactctataac
aaggcggacgcgcagcagccaggctcggccagcaccaacgtggtcctgcgccacgatggc
gccgtgcgctgggacgcaccggccatcacgcgcagctcgtgccgcgtggacgtggcggcc
ttcccgttcgacgcccagcgctgtggcctgacgttcggctcctggactcacggcgggcac
caactggatgtgcggccgcgcggcgctgccgccagcctggcggacttcgtggagaacgtg
gagtggcgcgtgctgggtatgccggcgcggcggcgcgtgctcacctacggctgctgctca
gagccctaccccgacgtcaccttcacgctgctgctgcaccgccgcgccgccgcctacgtg
tgcaacctgctgctgccctgcgtgctcatctcgctgcttgcgccgctcgccttccacctg
cccgccgactcgggcgagaaggtgtcgttgggcatcaccgtgctgctggcgctcaccgtc
ttccagctgctgctggctgagagcatgccgccggccgagagcgtgccgctcatcgggaag
tactacatggccactatgaccatggtcacattctcaacagcactcactatccttatcatg
aacctgcattactgtggtcccagtgcccgcccagtgccagcctgggctagggccctcctg
ctgggacacctggcacagagcctgtgcgtgcaggaaagaggggagccctgtgggcagtcc
aggccacctgagttatcccctagcccccagtctcccgaaggagaggctggccccccagcg
ggcccttgccacgagccacgatgtctgtgccgccaggaagccctactgcaccatgtagcc
accattgccaataccttccgcagccaccgagctgcgcagcgctgccatgaggactggaag
cgcctggcccgtgtgatggaccgcttcttcctgggcatcttcttctccatggccctggtc
atgagcctcctggtgctggtgcaggccctgtga

DBGET integrated database retrieval system