KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104665322
Entry
104665322         CDS       T03989                                 

Gene name
KL
Definition
(RefSeq) klotho
  KO
K14756  klotho [EC:3.2.1.31]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00040  Pentose and glucuronate interconversions
rro00053  Ascorbate and aldarate metabolism
rro01100  Metabolic pathways
rro04211  Longevity regulating pathway
rro04928  Parathyroid hormone synthesis, secretion and action
rro04961  Endocrine and other factor-regulated calcium reabsorption
Module
rro_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    104665322 (KL)
   00053 Ascorbate and aldarate metabolism
    104665322 (KL)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    104665322 (KL)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    104665322 (KL)
  09149 Aging
   04211 Longevity regulating pathway
    104665322 (KL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rro02000]
    104665322 (KL)
   04147 Exosome [BR:rro04147]
    104665322 (KL)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.31  beta-glucuronidase
     104665322 (KL)
Transporters [BR:rro02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   104665322 (KL)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104665322 (KL)
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-GeneID: 104665322
NCBI-ProteinID: XP_030778249
LinkDB
Position
18
AA seq 1012 aa
MPASAPPRRPRPPPPSLSLLLVLLALGGRRLRAETGDGAQTWARFARPPAPEAAGLFQGT
FPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRIANLPSGAPSPPQPA
TADVASDSYNNVFRDTEALRELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERL
RELGVQPVVTLYHWDLPQRLQDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNP
YVVAWHGYATGRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS
HWINPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSLLPDFTESEKKFI
KGTADFFALSFGPTLSFQLLDPHMKFRQLESPSLRQLLSWIDLEYNHPQIFIVENGWFVS
GTTKRDDAKYMYYLKKFIMETLKAIKLDGVDVIGYTAWSLMDGFEWHRGYSIRRGLFYVD
FLSQEKTLLPKSSALFYQKLIEKNGFPPLPENQPLEGTFPCDFAWGIVDNYIQVDTTLSQ
FTDLNVYLWDVHHSKRLIKVDGVVTKKRKSYCVDFAAIQPQITLLQEMHVTHFRFSLDWA
LILPLGNQSQVNHTILQYYRCMVSELVRVNITPVVALWQPVAPNQGLPRLLARQGAWENP
YTALAFAEYARLCFQELGGHVKLWITMNEPYTRNMTYSAGHNLLKAHALAWHVYNEKFRH
AQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGSGDYPWVMRDWLNQ
RNNFLLPYFTEDEKKLIQGTFDFLALSHYTTILVDSEKEDPIKYNDYLEVQEMTDITWLN
SPSQVAVVPWGLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALK
AHILDGINLCGYFAYSFNDRTAPRFGLYRFAADQFEPKPSMKHYRKIIDSNGFPGPETLE
KFCPEEFTMCTECSFFHTRKPLVAFIAFLFLAFIVSLSLIFYYSKKGRRRYK
NT seq 3039 nt   +upstreamnt  +downstreamnt
atgcccgccagcgccccgccgcgccgcccgcggccgccgccgccgtcgctgtcgctgctg
ctggtgctgctggccctgggcggccgccgcctgcgcgcggagacgggcgacggcgcgcag
acctgggcccgcttcgcgcgccctcccgcccccgaggccgcgggcctcttccagggcacc
ttccccgacggcttcctctgggccgtgggcagcgccgcctaccagaccgagggcggctgg
cagcagcacggcaagggtgcgtccatctgggacacgttcacccaccaccccttggcaccc
ccgggagactcccggatcgccaatctgccgtcgggcgccccgtcgccgccgcagcccgcc
accgcggacgtggccagcgacagctacaacaacgtcttccgcgacacggaggcgctgcgc
gagctcggggtcacccactaccgcttctccatctcgtgggcgcgggtgctccccaatggc
agcgcgggcgtccccaaccgcgaggggctccgctactaccggcgcctgctggagcggctg
cgggagctgggcgtgcagccagtggtcacgctgtaccactgggacctgccccagcgcctg
caggacgcctacggtggctgggccaaccgcgccctggccgaccacttcagggattacgcg
gagctctgcttccgccacttcggcggccaggtcaagtactggatcaccatcgacaacccc
tacgtcgtggcctggcacggctacgccaccgggcgcctggcccccggcatccggggcagc
ccgcggcttgggtacctggtggcgcacaacctcctcctggctcatgccaaagtctggcat
ctctacaatacttctttccgtcccactcagggaggccaggtgtccatcgccctaagctct
cactggatcaatcctcgaagaatgaccgaccatagcatcaaagaatgtcaaaaatctctg
gactttgtactaggctggtttgccaaacccgtatttatcgatggtgactatcccgagagc
atgaagaataacctttcgtctcttctgcctgattttactgaatctgagaaaaagttcatc
aaaggaactgctgacttttttgctctttcctttggcccaaccttgagttttcaacttttg
gaccctcacatgaaattccgccaattagaatctcccagcctgagacaactgctttcctgg
attgaccttgaatataaccatcctcaaatatttattgtggaaaatggctggtttgtctca
gggaccactaagagagatgatgccaaatatatgtattacctcaaaaagttcatcatggaa
accttaaaagccatcaagctagatggggtggatgtcatcgggtacaccgcgtggtccctc
atggacggtttcgagtggcacagaggttacagcatcaggcgtggactcttctatgtcgac
tttctaagccaagaaaagacgttgttgccaaagtcttcagccttgttctaccaaaagctg
atagagaaaaatggcttccctcctttacctgaaaatcagcccctagaagggacatttccc
tgtgactttgcttggggaattgttgacaactacattcaagtagacaccactctgtctcag
tttaccgacctgaatgtttacctgtgggatgtccaccacagtaaaaggcttattaaagtg
gatggggttgtgaccaagaagaggaaatcctattgtgttgactttgccgccatccagccc
cagatcactttactccaggaaatgcacgttacgcatttccgcttctccctggactgggcc
ctgattctccctctgggtaaccagtcccaggtaaaccacaccatcctacagtactatcgc
tgcatggtcagcgagcttgtccgtgtcaacatcaccccggtggtggccctgtggcagcct
gtggccccgaaccaaggactgccgcgcctcctggccaggcagggtgcctgggagaacccc
tacactgccctggcctttgcggagtatgcccgactgtgctttcaagagctcggcggtcac
gtcaagctttggataacgatgaatgagccgtatacaaggaacatgacatacagtgccggc
cacaacctcctgaaggcccatgccctggcttggcatgtgtataatgaaaagtttaggcat
gctcagaatgggaaaatatccatagccttgcaggctgattggatagaacctgcctgccct
ttctcccaaaaggacaaagaagtggccgagagagttttggaatttgacattggctggctg
gctgagccgattttcggctctggagattatccatgggtgatgagggactggctgaaccaa
agaaacaattttcttcttccttatttcactgaagatgaaaaaaagctaatccagggtacc
tttgactttttggctttaagccattataccaccatccttgtagactcagaaaaagaagat
ccaataaaatacaatgattacctagaagtgcaagaaatgactgacatcacgtggctcaac
tcccccagtcaggtggcagtggtgccctgggggttgcgcaaagtactgaactggctgaag
ttcaagtacggagacctccccatgtacataatatccaacggaatcgacgatgggctgcat
gctgaggacgaccagctgagggtgtattatatgcagaattacataaacgaagctctcaaa
gcccacatactggatggtatcaatctttgcggatactttgcttattcgtttaacgatcgc
acagccccgaggtttggcctctatcgctttgctgcagatcagtttgagcccaagccatcc
atgaaacattacaggaaaattattgacagcaatggtttcccgggcccagaaactctggaa
aaattttgtccagaagaattcaccatgtgtactgagtgcagttttttccacacccgaaag
cctttagtggctttcatagcttttctatttttggcttttattgtttctctctcccttata
ttttactactcgaagaaaggcagaagacgttacaaatag

DBGET integrated database retrieval system