KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104665644
Entry
104665644         CDS       T03989                                 

Gene name
ACTC1
Definition
(RefSeq) actin, alpha cardiac muscle 1
  KO
K12314  actin, alpha cardiac muscle
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104665644 (ACTC1)
   04261 Adrenergic signaling in cardiomyocytes
    104665644 (ACTC1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104665644 (ACTC1)
   05414 Dilated cardiomyopathy
    104665644 (ACTC1)
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     104665644 (ACTC1)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   104665644 (ACTC1)
  Exosomal proteins of bladder cancer cells
   104665644 (ACTC1)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 104665644
NCBI-ProteinID: XP_010365837
UniProt: A0A2K6QJH6
LinkDB
Position
5
AA seq 377 aa
MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
KQEYDEAGPSIVHRKCF
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtgtgacgacgaggagaccaccgccctggtgtgcgacaacggctctgggctggtgaag
gccggcttcgcgggcgatgacgcgccccgcgctgtcttcccgtccatcgtgggccgccca
cggcaccagggagttatggtgggtatgggtcagaaggactcctatgtaggtgatgaagcc
cagagcaagcgaggcatcctgaccctgaagtaccccatcgagcacggtatcatcaccaac
tgggacgacatggagaagatctggcaccacaccttctacaatgagctccgggtggctccc
gaggagcaccccaccctgctcacagaggccccgctgaaccccaaggccaaccgggagaag
atgactcagatcatgtttgagaccttcaatgtccctgccatgtacgtggccatccaggca
gtgctatccctgtatgcttctggccgcaccacaggcattgtcctggactctggggatggt
gtaactcacaatgtccccatctacgagggctacgctttgccccatgccatcatgcgtctg
gatctggctggtcgggacctcactgactacctcatgaagatcctcactgagcgtggctac
tcctttgtcaccactgctgaacgtgaaattgttcgtgacattaaggagaagctgtgctat
gtcgccctggattttgagaatgagatggccacagctgcctcttcctcctccctggagaag
agctatgaactgcctgatggccaagtcatcactattggcaatgagcgcttccgctgtcct
gagacgctcttccagccctccttcattggtatggaatctgctggcatccatgaaacaact
tacaatagcatcatgaagtgtgacattgatatccgcaaggacctgtatgctaacaatgtc
ttatctggaggcaccactatgtaccctggtattgctgatcgtatgcagaaggaaatcact
gccctggctcctagcaccatgaagattaagattattgctccccctgagcgtaaatactct
gtctggattgggggctccatcctggcctctctgtccaccttccagcagatgtggattagc
aagcaagagtacgatgaggcgggcccatccattgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system