KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104665907
Entry
104665907         CDS       T03989                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta type isoform X1
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04062  Chemokine signaling pathway
rro04064  NF-kappa B signaling pathway
rro04066  HIF-1 signaling pathway
rro04070  Phosphatidylinositol signaling system
rro04071  Sphingolipid signaling pathway
rro04150  mTOR signaling pathway
rro04270  Vascular smooth muscle contraction
rro04310  Wnt signaling pathway
rro04370  VEGF signaling pathway
rro04510  Focal adhesion
rro04540  Gap junction
rro04613  Neutrophil extracellular trap formation
rro04650  Natural killer cell mediated cytotoxicity
rro04662  B cell receptor signaling pathway
rro04666  Fc gamma R-mediated phagocytosis
rro04670  Leukocyte transendothelial migration
rro04713  Circadian entrainment
rro04720  Long-term potentiation
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04726  Serotonergic synapse
rro04727  GABAergic synapse
rro04728  Dopaminergic synapse
rro04730  Long-term depression
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04919  Thyroid hormone signaling pathway
rro04921  Oxytocin signaling pathway
rro04925  Aldosterone synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04929  GnRH secretion
rro04931  Insulin resistance
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro04960  Aldosterone-regulated sodium reabsorption
rro04961  Endocrine and other factor-regulated calcium reabsorption
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04972  Pancreatic secretion
rro04973  Carbohydrate digestion and absorption
rro05017  Spinocerebellar ataxia
rro05022  Pathways of neurodegeneration - multiple diseases
rro05031  Amphetamine addiction
rro05032  Morphine addiction
rro05140  Leishmaniasis
rro05143  African trypanosomiasis
rro05146  Amoebiasis
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05214  Glioma
rro05223  Non-small cell lung cancer
rro05225  Hepatocellular carcinoma
rro05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104665907 (PRKCB)
   04012 ErbB signaling pathway
    104665907 (PRKCB)
   04014 Ras signaling pathway
    104665907 (PRKCB)
   04015 Rap1 signaling pathway
    104665907 (PRKCB)
   04310 Wnt signaling pathway
    104665907 (PRKCB)
   04370 VEGF signaling pathway
    104665907 (PRKCB)
   04064 NF-kappa B signaling pathway
    104665907 (PRKCB)
   04066 HIF-1 signaling pathway
    104665907 (PRKCB)
   04020 Calcium signaling pathway
    104665907 (PRKCB)
   04070 Phosphatidylinositol signaling system
    104665907 (PRKCB)
   04071 Sphingolipid signaling pathway
    104665907 (PRKCB)
   04150 mTOR signaling pathway
    104665907 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104665907 (PRKCB)
   04540 Gap junction
    104665907 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    104665907 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    104665907 (PRKCB)
   04662 B cell receptor signaling pathway
    104665907 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    104665907 (PRKCB)
   04670 Leukocyte transendothelial migration
    104665907 (PRKCB)
   04062 Chemokine signaling pathway
    104665907 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    104665907 (PRKCB)
   04929 GnRH secretion
    104665907 (PRKCB)
   04912 GnRH signaling pathway
    104665907 (PRKCB)
   04921 Oxytocin signaling pathway
    104665907 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    104665907 (PRKCB)
   04918 Thyroid hormone synthesis
    104665907 (PRKCB)
   04919 Thyroid hormone signaling pathway
    104665907 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    104665907 (PRKCB)
   04916 Melanogenesis
    104665907 (PRKCB)
   04925 Aldosterone synthesis and secretion
    104665907 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104665907 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    104665907 (PRKCB)
   04971 Gastric acid secretion
    104665907 (PRKCB)
   04972 Pancreatic secretion
    104665907 (PRKCB)
   04973 Carbohydrate digestion and absorption
    104665907 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    104665907 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    104665907 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    104665907 (PRKCB)
   04727 GABAergic synapse
    104665907 (PRKCB)
   04725 Cholinergic synapse
    104665907 (PRKCB)
   04728 Dopaminergic synapse
    104665907 (PRKCB)
   04726 Serotonergic synapse
    104665907 (PRKCB)
   04720 Long-term potentiation
    104665907 (PRKCB)
   04730 Long-term depression
    104665907 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    104665907 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104665907 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104665907 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104665907 (PRKCB)
   05206 MicroRNAs in cancer
    104665907 (PRKCB)
   05205 Proteoglycans in cancer
    104665907 (PRKCB)
   05231 Choline metabolism in cancer
    104665907 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104665907 (PRKCB)
   05214 Glioma
    104665907 (PRKCB)
   05223 Non-small cell lung cancer
    104665907 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    104665907 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    104665907 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    104665907 (PRKCB)
   05032 Morphine addiction
    104665907 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    104665907 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104665907 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104665907 (PRKCB)
   05161 Hepatitis B
    104665907 (PRKCB)
   05171 Coronavirus disease - COVID-19
    104665907 (PRKCB)
   05164 Influenza A
    104665907 (PRKCB)
   05163 Human cytomegalovirus infection
    104665907 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104665907 (PRKCB)
   05140 Leishmaniasis
    104665907 (PRKCB)
   05143 African trypanosomiasis
    104665907 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104665907 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104665907 (PRKCB)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     104665907 (PRKCB)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   104665907 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 104665907
NCBI-ProteinID: XP_030780842
LinkDB
Position
20
AA seq 673 aa
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEGNEE
LRQKFERAKISQGTKVPEEKTTNTVSKFDNNGSRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFS
FVNSEFLKPEVKS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgagcgagggcgaggagagcaccgtgcgcttc
gcccgcaaaggcgccctccggcagaagaatgtgcacgaggtcaagaaccacaaatttacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcagggattccagtgccaagtttgctgctttgtggtgcacaagcggtgccatgaa
tttgtcacattctcctgccctggcgctgacaagggtccagcctctgatgatccccggagc
aaacacaagtttaagatccacacgtactccagtcccacgttttgtgaccactgtgggtca
ttgctgtatggactcatccatcaggggatgaaatgtgacacctgcatgatgaacgtgcac
aagcgctgcgtgatgaacgtccccagcctctgtggcacagaccacacggagcgccgcggc
cgcatctacatccaggcccacatcgacagggatgtcctcatcgtcctcgtaagagatgct
aaaaaccttgtacctatggaccccaatggcctgtcagatccctacgtaaaactgaaactg
attcctgatcccaaaagtgagagcaaacagaagaccaaaaccatcaaatgctccctcaac
cctgagtggaacgagacatttagatttcagctgaaagagtcggacaaagacagacgactg
tcagtagagatttgggattgggatttgaccagcaggaatgacttcatgggatctttgtcc
tttgggatttctgaacttcagaaagccagtgttgatggctggtttaagttactgagccag
gaggaaggcgagtacttcaatgtgcctgtgccaccagaaggaagtgagggcaatgaagaa
ctgcggcagaaatttgagagggccaagatcagtcagggaaccaaggtcccagaagaaaag
acgaccaatactgtctccaaatttgacaacaatggcagcagagaccggatgaaactgact
gattttaacttcctaatggtgctggggaaaggcagctttggcaaggtcatgctttcagaa
cgaaaaggcacagatgagctctatgctgtgaagatcctgaagaaggatgtcgtgatccaa
gatgatgacgtggagtgcactatggtggagaagcgggtgctggccctgcccgggaagccg
cccttcctgacccagctccactcctgcttccagaccatggaccgcctgtactttgtgatg
gagtatgtcaacgggggcgacctcatgtatcacatccagcaagttggccggttcaaggag
ccccatgctgtattttacgctgcagaaattgccatcggtctgttcttcttacagagtaag
ggcatcatttaccgtgacctaaaacttgacaacgtgatgctcgattctgaggggcacatc
aagattgctgattttggcatgtgtaaggagaacatctgggatggggtgacaaccaagaca
ttctgtggcactccagactacatcgcccctgagataattgcttatcagccctatgggaag
tccgtggattggtgggcatttggagtcctgctgtatgaaatgttggctgggcaggcaccc
tttgaaggggaagatgaagatgaactcttccagtccatcatggaacacaacgtagcctat
cccaagtctatgtccaaggaagctgtggccatctgcaaaggactgatgaccaaacacccg
ggcaaacgtttgggttgtggacctgaaggcgaacgtgatatcaaagagcatgcatttttc
cggtatattgattgggagaaacttgaacgcaaagagatccagcccccatataagccaaaa
gcttgtgggcgaaatgctgaaaacttcgaccgatttttcacccgccatccaccagtccta
acacctcccgaccaggaagtcatcaggaatattgaccaatcagaattcgaaggattttcc
tttgttaactctgaatttttaaaacccgaagtcaagagctaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675428
Entry
104675428         CDS       T03989                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type isoform X1
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04066  HIF-1 signaling pathway
rro04070  Phosphatidylinositol signaling system
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04310  Wnt signaling pathway
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04510  Focal adhesion
rro04540  Gap junction
rro04613  Neutrophil extracellular trap formation
rro04650  Natural killer cell mediated cytotoxicity
rro04664  Fc epsilon RI signaling pathway
rro04666  Fc gamma R-mediated phagocytosis
rro04670  Leukocyte transendothelial migration
rro04713  Circadian entrainment
rro04720  Long-term potentiation
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04726  Serotonergic synapse
rro04727  GABAergic synapse
rro04728  Dopaminergic synapse
rro04730  Long-term depression
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04919  Thyroid hormone signaling pathway
rro04921  Oxytocin signaling pathway
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04928  Parathyroid hormone synthesis, secretion and action
rro04929  GnRH secretion
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro04960  Aldosterone-regulated sodium reabsorption
rro04961  Endocrine and other factor-regulated calcium reabsorption
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04972  Pancreatic secretion
rro05017  Spinocerebellar ataxia
rro05022  Pathways of neurodegeneration - multiple diseases
rro05031  Amphetamine addiction
rro05032  Morphine addiction
rro05143  African trypanosomiasis
rro05146  Amoebiasis
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05214  Glioma
rro05223  Non-small cell lung cancer
rro05225  Hepatocellular carcinoma
rro05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104675428 (PRKCA)
   04012 ErbB signaling pathway
    104675428 (PRKCA)
   04014 Ras signaling pathway
    104675428 (PRKCA)
   04015 Rap1 signaling pathway
    104675428 (PRKCA)
   04310 Wnt signaling pathway
    104675428 (PRKCA)
   04370 VEGF signaling pathway
    104675428 (PRKCA)
   04066 HIF-1 signaling pathway
    104675428 (PRKCA)
   04020 Calcium signaling pathway
    104675428 (PRKCA)
   04070 Phosphatidylinositol signaling system
    104675428 (PRKCA)
   04072 Phospholipase D signaling pathway
    104675428 (PRKCA)
   04071 Sphingolipid signaling pathway
    104675428 (PRKCA)
   04151 PI3K-Akt signaling pathway
    104675428 (PRKCA)
   04150 mTOR signaling pathway
    104675428 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104675428 (PRKCA)
   04540 Gap junction
    104675428 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    104675428 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    104675428 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    104675428 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    104675428 (PRKCA)
   04670 Leukocyte transendothelial migration
    104675428 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    104675428 (PRKCA)
   04929 GnRH secretion
    104675428 (PRKCA)
   04912 GnRH signaling pathway
    104675428 (PRKCA)
   04921 Oxytocin signaling pathway
    104675428 (PRKCA)
   04926 Relaxin signaling pathway
    104675428 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    104675428 (PRKCA)
   04918 Thyroid hormone synthesis
    104675428 (PRKCA)
   04919 Thyroid hormone signaling pathway
    104675428 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    104675428 (PRKCA)
   04916 Melanogenesis
    104675428 (PRKCA)
   04925 Aldosterone synthesis and secretion
    104675428 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104675428 (PRKCA)
   04270 Vascular smooth muscle contraction
    104675428 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    104675428 (PRKCA)
   04971 Gastric acid secretion
    104675428 (PRKCA)
   04972 Pancreatic secretion
    104675428 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    104675428 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    104675428 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    104675428 (PRKCA)
   04727 GABAergic synapse
    104675428 (PRKCA)
   04725 Cholinergic synapse
    104675428 (PRKCA)
   04728 Dopaminergic synapse
    104675428 (PRKCA)
   04726 Serotonergic synapse
    104675428 (PRKCA)
   04720 Long-term potentiation
    104675428 (PRKCA)
   04730 Long-term depression
    104675428 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    104675428 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104675428 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    104675428 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104675428 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104675428 (PRKCA)
   05206 MicroRNAs in cancer
    104675428 (PRKCA)
   05205 Proteoglycans in cancer
    104675428 (PRKCA)
   05231 Choline metabolism in cancer
    104675428 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104675428 (PRKCA)
   05214 Glioma
    104675428 (PRKCA)
   05223 Non-small cell lung cancer
    104675428 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    104675428 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    104675428 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    104675428 (PRKCA)
   05032 Morphine addiction
    104675428 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104675428 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104675428 (PRKCA)
   05161 Hepatitis B
    104675428 (PRKCA)
   05171 Coronavirus disease - COVID-19
    104675428 (PRKCA)
   05164 Influenza A
    104675428 (PRKCA)
   05163 Human cytomegalovirus infection
    104675428 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104675428 (PRKCA)
   05143 African trypanosomiasis
    104675428 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104675428 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104675428 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104675428 (PRKCA)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     104675428 (PRKCA)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   104675428 (PRKCA)
Membrane trafficking [BR:rro04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    104675428 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 APH
Other DBs
NCBI-GeneID: 104675428
NCBI-ProteinID: XP_010378287
UniProt: A0A2K6RMH9
LinkDB
Position
19
AA seq 672 aa
MADVFPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggctgacgttttcccggccaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaaggaccacaaattcatc
gcgcgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggattt
gggaaacagggcttccagtgccaagtttgctgttttgtggtccacaagaggtgccatgaa
tttgttactttttcttgtccgggtgcggataagggacccgacactgatgaccccaggagc
aagcacaagttcaaaatccacacttatggaagccccaccttctgcgatcactgtgggtcc
ctgctatatggacttatccaccaagggatgaaatgtgacacctgcgatatgaacgttcac
aagcagtgcgtcatcaatgtccccagcctctgtggaatggatcacacagagaagaggggg
cggatttacctaaaggctgaggttgctgatgaaaagctccatgtcacagtacgagatgca
aaaaatctaatccctatggatccaaacgggctttcagatccttatgtgaagctgaaactt
attcctgatcccaagaatgaaagcaaacaaaaaaccaaaaccatccgctccacactaaat
ccccagtggaatgagtcctttacattcaaattgaaaccttcagacaaagaccgacgactg
tctgtagaaatctgggactgggatcgaacaacaaggaatgacttcatgggatccctttcc
tttggggtttcggagctaatgaagatgccagccagtggatggtacaagttgcttaaccaa
gaagaaggtgagtactacaatgtacccattccagaaggggacgaagaaggaaacatggaa
ctcaggcagaaattcgagaaagccaagcttggccctgctggcaacaaagtcatcagtccc
tctgaagacaggaaacaaccttccaacaacctggaccgagtgaaactcaccgacttcaat
ttcctcatggtgctggggaaggggagttttggaaaggtgatgcttgccgacaggaagggc
acagaagaactgtacgcaatcaaaatcctgaagaaggatgtggtgattcaggatgatgac
gtggagtgcaccatggtagaaaagcgagtcttggctctgcttgacaaacccccattcttg
acgcagctgcactcctgcttccagacagtggatcggctgtacttcgtcatggaatatgtc
aacggtggggacctcatgtaccacattcagcaagtaggaaaatttaaggaaccacaagca
gtattctatgcggcagagatttccatcggattgttctttcttcataaaagaggaatcatt
tatagggatctgaagttagataacgtcatgttggattcagaaggacatatcaaaattgct
gactttgggatgtgcaaggaacacatgatggatggagtcacgaccaggaccttctgtggg
actccagattacatcgccccagagattatcgcttatcagccatatggaaaatctgtggac
tggtgggcctatggcgtcctgttgtatgaaatgcttgctgggcagcctccatttgatggt
gaagatgaagatgagctatttcagtctatcatggagcacaacgtttcctatccaaaatcc
ttgtccaaggaggctgtttccatctgcaaaggactgatgaccaaacacccagccaagcgg
ctgggctgtgggcctgagggggagagggacgtgagagaacatgccttcttccggaggatc
gactgggaaaaactggagaacagggagatccagccaccattcaagcccaaagtgtgtggc
aaaggagcagaaaactttgacaagttcttcacacgagggcagcccgtcttaacaccgcct
gatcagctggttattgctaacatagaccagtctgattttgaagggttctcgtatgtcaac
ccccagtttgtgcaccccatcttacagagtgcagtatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104676027
Entry
104676027         CDS       T03989                                 

Gene name
PRKCG
Definition
(RefSeq) protein kinase C gamma type isoform X1
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04066  HIF-1 signaling pathway
rro04070  Phosphatidylinositol signaling system
rro04071  Sphingolipid signaling pathway
rro04150  mTOR signaling pathway
rro04270  Vascular smooth muscle contraction
rro04310  Wnt signaling pathway
rro04370  VEGF signaling pathway
rro04510  Focal adhesion
rro04540  Gap junction
rro04613  Neutrophil extracellular trap formation
rro04650  Natural killer cell mediated cytotoxicity
rro04666  Fc gamma R-mediated phagocytosis
rro04670  Leukocyte transendothelial migration
rro04713  Circadian entrainment
rro04720  Long-term potentiation
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04726  Serotonergic synapse
rro04727  GABAergic synapse
rro04728  Dopaminergic synapse
rro04730  Long-term depression
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04919  Thyroid hormone signaling pathway
rro04921  Oxytocin signaling pathway
rro04925  Aldosterone synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04929  GnRH secretion
rro04935  Growth hormone synthesis, secretion and action
rro04960  Aldosterone-regulated sodium reabsorption
rro04961  Endocrine and other factor-regulated calcium reabsorption
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04972  Pancreatic secretion
rro05017  Spinocerebellar ataxia
rro05022  Pathways of neurodegeneration - multiple diseases
rro05031  Amphetamine addiction
rro05032  Morphine addiction
rro05143  African trypanosomiasis
rro05146  Amoebiasis
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05214  Glioma
rro05223  Non-small cell lung cancer
rro05225  Hepatocellular carcinoma
rro05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104676027 (PRKCG)
   04012 ErbB signaling pathway
    104676027 (PRKCG)
   04014 Ras signaling pathway
    104676027 (PRKCG)
   04015 Rap1 signaling pathway
    104676027 (PRKCG)
   04310 Wnt signaling pathway
    104676027 (PRKCG)
   04370 VEGF signaling pathway
    104676027 (PRKCG)
   04066 HIF-1 signaling pathway
    104676027 (PRKCG)
   04020 Calcium signaling pathway
    104676027 (PRKCG)
   04070 Phosphatidylinositol signaling system
    104676027 (PRKCG)
   04071 Sphingolipid signaling pathway
    104676027 (PRKCG)
   04150 mTOR signaling pathway
    104676027 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104676027 (PRKCG)
   04540 Gap junction
    104676027 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    104676027 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    104676027 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    104676027 (PRKCG)
   04670 Leukocyte transendothelial migration
    104676027 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    104676027 (PRKCG)
   04929 GnRH secretion
    104676027 (PRKCG)
   04921 Oxytocin signaling pathway
    104676027 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    104676027 (PRKCG)
   04918 Thyroid hormone synthesis
    104676027 (PRKCG)
   04919 Thyroid hormone signaling pathway
    104676027 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    104676027 (PRKCG)
   04916 Melanogenesis
    104676027 (PRKCG)
   04925 Aldosterone synthesis and secretion
    104676027 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104676027 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    104676027 (PRKCG)
   04971 Gastric acid secretion
    104676027 (PRKCG)
   04972 Pancreatic secretion
    104676027 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    104676027 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    104676027 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    104676027 (PRKCG)
   04727 GABAergic synapse
    104676027 (PRKCG)
   04725 Cholinergic synapse
    104676027 (PRKCG)
   04728 Dopaminergic synapse
    104676027 (PRKCG)
   04726 Serotonergic synapse
    104676027 (PRKCG)
   04720 Long-term potentiation
    104676027 (PRKCG)
   04730 Long-term depression
    104676027 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    104676027 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104676027 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104676027 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104676027 (PRKCG)
   05206 MicroRNAs in cancer
    104676027 (PRKCG)
   05205 Proteoglycans in cancer
    104676027 (PRKCG)
   05231 Choline metabolism in cancer
    104676027 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104676027 (PRKCG)
   05214 Glioma
    104676027 (PRKCG)
   05223 Non-small cell lung cancer
    104676027 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    104676027 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    104676027 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    104676027 (PRKCG)
   05032 Morphine addiction
    104676027 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104676027 (PRKCG)
   05161 Hepatitis B
    104676027 (PRKCG)
   05171 Coronavirus disease - COVID-19
    104676027 (PRKCG)
   05163 Human cytomegalovirus infection
    104676027 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104676027 (PRKCG)
   05143 African trypanosomiasis
    104676027 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104676027 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104676027 (PRKCG)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     104676027 (PRKCG)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   104676027 (PRKCG)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like APH
Other DBs
NCBI-GeneID: 104676027
NCBI-ProteinID: XP_010379009
UniProt: A0A2K6PL72
LinkDB
Position
12
AA seq 697 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHITVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggctggtctgggccccggcggaggcgattcagagggaggaccccggcccctgttttgc
agaaagggggctctgaggcagaaggtggtccacgaagtcaagagccacaagttcaccgct
cgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggtatcgga
aagcaaggcctgcaatgtcaagtctgcagctttgtggttcatcgacgatgccacgaattt
gtgaccttcgagtgtccaggcgctgggaagggcccccagacggacgacccccggaacaag
cacaagttccgcctgcatagctacagcagccctactttctgcgaccactgtggctccctc
ctgtacgggcttgtgcaccagggcatgaaatgctcctgctgcgagatgaacgtgcaccgg
cgctgtgtgcgtagcgtgccctccctgtgcggtgtggaccacacggagcgccgcgggcgc
ctgcagctagagatccgggctcccactgcagatgagatccacataacggttggcgaggcc
cgtaaccttattcctatggaccccaatggtctctctgatccctatgtgaaactgaagctc
atcccagaccctcggaatctgacgaaacagaaaacccgaacggtgaaagccacgctaaat
cctgtgtggaatgagacctttgtgttcaacctgaagcctggggatgtggagcgccggctc
agcgtggaggtgtgggactgggaccggacctcccgcaacgacttcatgggtgccatgtct
tttggcgtctcggagctgctcaaggcgccagtggatggctggtacaagttactgaaccag
gaggagggcgagtattacaatgtgccggtggccgatgctgacaactgcagcctcctccag
aagtttgaggcttgtaactaccccctggaattgtatgagcgggtgcggatgggcccctct
tcctctcccatcccctccccttcccctagtcccaccgaccccaagcgctgcttcttcggg
gcaagcccaggacgtctgcacatctccgacttcagcttcctcatggttctaggaaaaggc
agttttgggaaggtgatgctggccgagcgcaggggctctgatgagctttacgccatcaaa
atcctgaaaaaggacgtgatcgtccaggacgacgacgtggactgcacgctggtggagaaa
cgcgtgctggcgctggggggccggggtcctggcggccggccccacttcctcacccaactc
cactccaccttccagaccccggaccgcctgtatttcgtgatggagtacgtcacgggggga
gacttgatgtaccacattcaacagctgggcaagtttaaggagccccatgcagcgttctac
gcagcagaaatcgccatcggcctcttcttccttcacaatcagggcatcatctacagggac
ctgaagctggacaatgtgatgctggatgctgagggacacatcaagatcactgacttcggc
atgtgtaaggagaacgtcttccccgggacgacaacccgcaccttctgcgggaccccggac
tacatagccccggagatcattgcctaccagccctatgggaagtctgtcgattggtggtcc
tttggagttctgctctatgagatgttggcaggacagcctcccttcgatggggaggatgaa
gaagagctgtttcaggccatcatggaacaaactgtcacctaccccaagtcgctttctcgg
gaagccgtggccatctgcaaggggttcctgaccaagcacccagggaagcggctgggctca
gggcctgatggggaacctaccatccgtgcacatggctttttccgctggattgactgggaa
cggctggaacgattggagatcccgcctcctttcagaccccgcccgtgtggccgcagcggc
gagaactttgacaagttcttcacgcgggcggcgccagcgctaacccctccagaccgccta
gtcctggccagcatcgaccaggccgatttccaggggtttacctacgtgaaccccgacttc
gtgcatccggatgcccgcagccccaccagcccagtgcctgtgcccgtcatgtaa

DBGET integrated database retrieval system