KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104666241
Entry
104666241         CDS       T03989                                 

Gene name
PRKAB1
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-1 isoform X1
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04068  FoxO signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04371  Apelin signaling pathway
rro04530  Tight junction
rro04710  Circadian rhythm
rro04714  Thermogenesis
rro04910  Insulin signaling pathway
rro04920  Adipocytokine signaling pathway
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104666241 (PRKAB1)
   04068 FoxO signaling pathway
    104666241 (PRKAB1)
   04152 AMPK signaling pathway
    104666241 (PRKAB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104666241 (PRKAB1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104666241 (PRKAB1)
   04922 Glucagon signaling pathway
    104666241 (PRKAB1)
   04920 Adipocytokine signaling pathway
    104666241 (PRKAB1)
   04921 Oxytocin signaling pathway
    104666241 (PRKAB1)
  09149 Aging
   04211 Longevity regulating pathway
    104666241 (PRKAB1)
   04213 Longevity regulating pathway - multiple species
    104666241 (PRKAB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    104666241 (PRKAB1)
   04714 Thermogenesis
    104666241 (PRKAB1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104666241 (PRKAB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104666241 (PRKAB1)
   04931 Insulin resistance
    104666241 (PRKAB1)
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48 DUF4758
Other DBs
NCBI-GeneID: 104666241
NCBI-ProteinID: XP_010366576
UniProt: A0A2K6R5X3
LinkDB
Position
10
AA seq 270 aa
MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEF
LAWQHDLEVNDKAPTQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 813 nt   +upstreamnt  +downstreamnt
atgggcaacacgagcagtgagcgcgccgcgctggagcggcatggtggccataagacgccc
cggagggacagctccgggggcaccaaggacggggacaggcccaagatcctgatggacagc
cccgaagacgccgacctcttccactccgaggaaatcaaggcaccggagaaggaggaattc
ctggcctggcagcatgatctggaagtgaatgataaagcccccacccaggctcggccaact
gtgtttcggtggacggggggcggaaaggaagtttacttatctgggtcttttaacaactgg
agtaaacttcccctcaccagaagccacaataactttgtagccatcctggatctgccggaa
ggagagcatcagtacaagttctttgtggatggtcagtggacccacgacccttccgagccc
atagtaaccagccagcttggcacagttaacaacatcattcaagtgaagaaaactgacttt
gaagtatttgatgctttaatggtggattcccaaaagtgctccgatgtatctgagctgtcc
agctccccgccgggaccctaccatcaggagccctatgtctgcaaacccgaagagcgcttt
cgggcgccacccattctccccccgcatctcctccaggtcatcctgaacaaggacacaggg
atttcctgtgatccagctttgctccctgagcccaatcatgtcatgctgaaccacctgtac
gcgctgtctatcaaggatggcgtgatggtgctcagcgcaacccaccggtacaagaagaag
tatgtcaccaccttgttatacaagcccatatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104678672
Entry
104678672         CDS       T03989                                 

Gene name
PRKAB2
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-2
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04068  FoxO signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04371  Apelin signaling pathway
rro04530  Tight junction
rro04710  Circadian rhythm
rro04714  Thermogenesis
rro04910  Insulin signaling pathway
rro04920  Adipocytokine signaling pathway
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104678672 (PRKAB2)
   04068 FoxO signaling pathway
    104678672 (PRKAB2)
   04152 AMPK signaling pathway
    104678672 (PRKAB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104678672 (PRKAB2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104678672 (PRKAB2)
   04922 Glucagon signaling pathway
    104678672 (PRKAB2)
   04920 Adipocytokine signaling pathway
    104678672 (PRKAB2)
   04921 Oxytocin signaling pathway
    104678672 (PRKAB2)
  09149 Aging
   04211 Longevity regulating pathway
    104678672 (PRKAB2)
   04213 Longevity regulating pathway - multiple species
    104678672 (PRKAB2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    104678672 (PRKAB2)
   04714 Thermogenesis
    104678672 (PRKAB2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104678672 (PRKAB2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104678672 (PRKAB2)
   04931 Insulin resistance
    104678672 (PRKAB2)
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Other DBs
NCBI-GeneID: 104678672
NCBI-ProteinID: XP_010382302
UniProt: A0A2K6NK61
LinkDB
Position
8
AA seq 272 aa
MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFV
SWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPE
GEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSLESSETSCRD
LSSSPPGPYGQEMYVFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNH
LYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
NT seq 819 nt   +upstreamnt  +downstreamnt
atgggaaacaccaccagcgaccgggtgtccggggagcgccacggtgccaaggctgcccgc
tccgagggcgcaggcggtcatgccccggggaaggagcacaagatcatggtgggcagtacg
gacgaccccagcgtgttcagcctccccgactccaagctccctggggacaaagagtttgta
tcatggcagcaggatttggaggactccgtaaagcccacacagcaggcccggcccactgtt
atccgctggtctgaaggaggcaaggaggtcttcatctctgggtccttcaacaattggagc
accaagattccactgattaagagccataatgactttgttgccatcctggacctccctgag
ggagaacatcagtacaagttctttgtggatggacagtgggttcatgatccatcagagcct
gtggttaccagtcagctcggcacaattaacaatttgatccatgtcaagaaatctgatttt
gaggtgtttgatgctttaaagctagattctttggaaagttctgagacatcttgtagagac
ctttccagctcacccccagggccttatggtcaagaaatgtatgtgtttcgatctgaggaa
agattcaaatccccacccatccttcctcctcatctacttcaagttattcttaacaaagac
actaatatttcttgtgacccagccttactccctgagcccaaccatgttatgctgaaccat
ctctatgcattgtccattaaggacagtgtgatggtccttagtgcaacccatcgctacaag
aagaagtatgttactactctgctatacaagcccatctga

DBGET integrated database retrieval system