KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104666279
Entry
104666279         CDS       T03989                                 

Gene name
ORAI1
Definition
(RefSeq) calcium release-activated calcium channel protein 1
  KO
K16056  calcium release-activated calcium channel protein 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04020  Calcium signaling pathway
rro04024  cAMP signaling pathway
rro04611  Platelet activation
rro04924  Renin secretion
rro04925  Aldosterone synthesis and secretion
rro04927  Cortisol synthesis and secretion
rro04934  Cushing syndrome
rro05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    104666279 (ORAI1)
   04024 cAMP signaling pathway
    104666279 (ORAI1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104666279 (ORAI1)
  09152 Endocrine system
   04924 Renin secretion
    104666279 (ORAI1)
   04925 Aldosterone synthesis and secretion
    104666279 (ORAI1)
   04927 Cortisol synthesis and secretion
    104666279 (ORAI1)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    104666279 (ORAI1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104666279 (ORAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104666279 (ORAI1)
Ion channels [BR:rro04040]
 Other channels
  Calcium channel, calcium release-activated (Orai)
   104666279 (ORAI1)
SSDB
Motif
Pfam: Orai-1 m04gp34like
Other DBs
NCBI-GeneID: 104666279
NCBI-ProteinID: XP_010366633
UniProt: A0A2K6NDB5
LinkDB
Position
10
AA seq 300 aa
MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRCRSGDGEPPGAPPPPPAVTYPDWIGQSYS
EVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDADHDYPPGLLI
AFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTV
IGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQAAAIASTT
IMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHYA
NT seq 903 nt   +upstreamnt  +downstreamnt
atgcatccggagcccgccccgcccccgagccgcagcagccccgagcttcccccgagcggc
ggcagcaccaccagcggcagccgccggagccgctgccgcagcggggacggggaacctccg
ggagccccgccgccgccgcccgccgtcacctacccggactggatcggccagagttactcc
gaggtgatgagtctcaacgagcactccatgcaggcgctgtcctggcgcaagctctatttg
agccgcgccaagctcaaagcctccagccggacctcggctctgctctccggcttcgccatg
gtggcgatggtggaggtgcagctggacgctgaccacgactacccgccagggctgcttatc
gccttcagtgcctgcaccacggtgctggtggccgtacacctgtttgcactcatgatcagc
acctgcatcttgcccaacatcgaggcagtaagcaacgtgcacaacctcaactcagtcaag
gagtccccccacgagcgcatgcaccgccacatcgagctggcctgggccttctccaccgtc
atcggcacgctgctcttcctggccgaggtcgtgctgctctgctgggtcaagttcttgccc
ctcaagaagcagccaggccagccgaggcccaccagcaagccccccgccagtggtgcagct
gccaacgtcagcaccagcggcatcaccccgggccaggcagccgccatcgcctcgaccacc
atcatggtgccctttggcctgatctttatcgtcttcgccgtccacttctaccgctcactg
gtcagccataagacggaccgacagttccaggagctcaacgagctggcggagtttgctcgc
ttacaggaccagctggaccacagaggggaccaccccctgacgcccggcagccactatgcc
tag

DBGET integrated database retrieval system