KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104666425Help
Entry
104666425         CDS       T03989                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04068  FoxO signaling pathway
rro04146  Peroxisome
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104666425 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104666425 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    104666425 (SOD2)
   04213 Longevity regulating pathway - multiple species
    104666425 (SOD2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    104666425 (SOD2)
Enzymes [BR:rro01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     104666425 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 104666425
NCBI-ProteinID: XP_010366803
UniProt: A0A2K6NUA4
LinkDB All DBs
Position
Un
AA seq 222 aa AA seqDB search
MLSRAVCGTGRQLAPALGYLGSRQKHSLPDLPYDYGALEPHINAEIMQLHHSKHHAAYVN
NLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEA
IKRDFGSFEKFKEKLTAASVGVQGSGWGWLGFNKERGQLQIAACPNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgagccgggcagtttgcggcaccggcaggcagttggcgccggctttggggtatctg
ggctccaggcagaaacacagcctccccgacctgccctacgactacggcgccctggagcct
cacatcaacgcggagatcatgcagctgcaccacagcaagcaccacgcggcctacgtgaac
aacctgaacgtcaccgaggagaagtaccaggaggcgttggccaagggagatgttaccgcc
cagatagctcttcagcctgcactgaagttcaatggtggtggtcatatcaatcatagcatt
ttctggacaaacctcagccctaatggtggtggagaacccaaaggggagttgctggaagcc
atcaaacgtgactttggttcctttgaaaaatttaaggagaagctgacggctgcatctgtt
ggtgtccaaggctcaggttggggttggcttggttttaataaggaacggggacagttacaa
attgctgcttgtccaaatcaggatccactgcaaggaacaacaggccttattccactgctg
gggattgatgtgtgggagcacgcttattaccttcagtataaaaatgtcaggcctgattac
ctaaaagctatttggaatgtaatcaactgggagaatgtaactgaaagatacatggcttgc
aaaaagtaa

DBGET integrated database retrieval system