KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104666538Help
Entry
104666538         CDS       T03989                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00500  Starch and sucrose metabolism
rro01100  Metabolic pathways
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04910  Insulin signaling pathway
rro04922  Glucagon signaling pathway
rro04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    104666538 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104666538 (GYS1)
   04152 AMPK signaling pathway
    104666538 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104666538 (GYS1)
   04922 Glucagon signaling pathway
    104666538 (GYS1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04931 Insulin resistance
    104666538 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rro01003]
    104666538 (GYS1)
Enzymes [BR:rro01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     104666538 (GYS1)
Glycosyltransferases [BR:rro01003]
 Polysaccharide
  Storage polysaccharide
   104666538 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 104666538
NCBI-ProteinID: XP_010366916
UniProt: A0A2K6PY65
LinkDB All DBs
Position
Un
AA seq 737 aa AA seqDB search
MPLNRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEAPTPALKKTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALSKAFPEHFTYEPSEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EDPRNGPLEEDSERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLS
TPSEPLSPTSSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctttaaaccgcactttgtccatgtcctcactgccaggactggaggactgggaggat
gaattcgacctggagaacacagtgctcttcgaagtggcctgggaggtggccaacaaggtg
ggtggcatctacacggtgctgcagacgaaggcgaaggtgacgggggacgaatggggcgac
aactactacctggtggggccgtacacggagcagggcgtgaggacccaggtggaactgctg
gaggcccccaccccggccctgaagaagacactggattccatgaacagcaagggttgcaag
gtgtattttgggcgctggttgatcgagggaggccctctggtggtgctcctggatgtgggg
gcctcagcctgggccctggagcgctggaagggagagctctgggatacctgcaacatcgga
gtgccgtggtacgaccgcgaggccaacgatgctgtcctctttggctttctcaccacctgg
ttcctgggtgagttcctcgcgcagagtgaggagaagccacacgtggttgctcacttccat
gagtggttggcaggcattggactctgcctgtgtcgtgcccgacgactgcctgtagcaacc
atcttcaccacccatgccacgctgctggggcgctacctgtgtgccggtgctgtggacttc
tacaacaacctggagaacttcaatgtggacaaggaagcaggggagaggcagatttatcac
cgctactgcatggaaagagcggcagcccactgcgctcacgtcttcactactgtgtcccag
atcaccgccatcgaggcacagcacttgctcaaaaggaaaccagatattgtgacccccaat
gggctgaatgtgaagaagttttctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcatctggacttcaacttg
gacaagaccttgtacttctttatcgctggccgctatgagttctccaacaagggtgccgac
gtcttcctggaggccttggcccggctcaactatctgctcagagtgaatggcagcgagcag
actgtggttgccttcttcatcatgccggcgcggaccaacaatttcaacgtggaaaccctc
aaaggccaagccgtgcgcaaacagctttgggacacggccaacacggtgaaggagaagttc
gggaggaagctttatgaatccttactggttgggagccttcctgacatgaacaagatgctg
gataaggaagacttcactatgatgaagagagccatctttgcaacgcagcggcagtctttt
ccccctgtgtgcacccacaatatgctggatgactcctcagaccccatcctgaccaccatc
cgccgaatcggcctcttcaatagcagtgccgacagggtgaaggtgattttccacccagag
ttcctctcctccacaagccccctgctcccggtggactatgaggagtttgtccgtggctgt
caccttggggtcttcccatcctactatgagccttggggctacacgccggctgagtgcacg
gttatgggcatccccagtgtctccaccaatctctccggcttcggctgcttcatggaggaa
cacatcgcagacccctcagcttacggtatctacattctcgaccggcggttccgcagcctg
gatgattcctgctcgcagctcacctccttcctctacagcttctgtcagcagagccggcgg
cagcgtatcatccagcggaaccgcacggagcggctctccgaccttctggactggaaatac
ttaggccggtattatatgtctgcacgccacatggcgctgtccaaggcctttccagagcac
ttcacctacgagcccagcgaggcggatgcggcccaagggtaccgctacccacggccggcc
tcggtgccaccgtcgccctcgctgtcacgacactccagcccgcaccagagcgaggacgag
gaggatccccggaacgggcctctggaggaagacagcgagcgctacgatgaggacgaggag
gctgccaaggacaggcgcaacattcgtgcaccagagtggccgcgccgagcgtcctgcacc
tcctccaccagcgggagcaagcgcaactctgtggacacggccacctccagctcgctcagc
acccccagcgagcccctcagccccaccagctctctgggcgaggagcgtaactaa

DBGET integrated database retrieval system