KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104666540
Entry
104666540         CDS       T03989                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX isoform X1
  KO
K02159  apoptosis regulator BAX
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro01524  Platinum drug resistance
rro04071  Sphingolipid signaling pathway
rro04115  p53 signaling pathway
rro04141  Protein processing in endoplasmic reticulum
rro04210  Apoptosis
rro04211  Longevity regulating pathway
rro04215  Apoptosis - multiple species
rro04217  Necroptosis
rro04722  Neurotrophin signaling pathway
rro04932  Non-alcoholic fatty liver disease
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro05012  Parkinson disease
rro05014  Amyotrophic lateral sclerosis
rro05016  Huntington disease
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05203  Viral carcinogenesis
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05216  Thyroid cancer
rro05217  Basal cell carcinoma
rro05218  Melanoma
rro05220  Chronic myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104666540 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    104666540 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104666540 (BAX)
   04215 Apoptosis - multiple species
    104666540 (BAX)
   04217 Necroptosis
    104666540 (BAX)
   04115 p53 signaling pathway
    104666540 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104666540 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    104666540 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104666540 (BAX)
   05202 Transcriptional misregulation in cancer
    104666540 (BAX)
   05203 Viral carcinogenesis
    104666540 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104666540 (BAX)
   05212 Pancreatic cancer
    104666540 (BAX)
   05225 Hepatocellular carcinoma
    104666540 (BAX)
   05226 Gastric cancer
    104666540 (BAX)
   05214 Glioma
    104666540 (BAX)
   05216 Thyroid cancer
    104666540 (BAX)
   05220 Chronic myeloid leukemia
    104666540 (BAX)
   05217 Basal cell carcinoma
    104666540 (BAX)
   05218 Melanoma
    104666540 (BAX)
   05213 Endometrial cancer
    104666540 (BAX)
   05224 Breast cancer
    104666540 (BAX)
   05222 Small cell lung cancer
    104666540 (BAX)
   05223 Non-small cell lung cancer
    104666540 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    104666540 (BAX)
   05014 Amyotrophic lateral sclerosis
    104666540 (BAX)
   05016 Huntington disease
    104666540 (BAX)
   05020 Prion disease
    104666540 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    104666540 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104666540 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104666540 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104666540 (BAX)
   05152 Tuberculosis
    104666540 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104666540 (BAX)
   05170 Human immunodeficiency virus 1 infection
    104666540 (BAX)
   05161 Hepatitis B
    104666540 (BAX)
   05160 Hepatitis C
    104666540 (BAX)
   05164 Influenza A
    104666540 (BAX)
   05162 Measles
    104666540 (BAX)
   05168 Herpes simplex virus 1 infection
    104666540 (BAX)
   05163 Human cytomegalovirus infection
    104666540 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104666540 (BAX)
   05169 Epstein-Barr virus infection
    104666540 (BAX)
   05165 Human papillomavirus infection
    104666540 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104666540 (BAX)
   01524 Platinum drug resistance
    104666540 (BAX)
   01522 Endocrine resistance
    104666540 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rro03029]
    104666540 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rro02000]
    104666540 (BAX)
Mitochondrial biogenesis [BR:rro03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    104666540 (BAX)
Transporters [BR:rro02000]
 Other transporters
  Pores ion channels [TC:1]
   104666540 (BAX)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 104666540
NCBI-ProteinID: XP_010366919
UniProt: A0A2K6NSH2
LinkDB
Position
12
AA seq 192 aa
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELALDPVPQDASTKRLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTILVAGV
LTASLTIWKKMG
NT seq 579 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcagcccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatggggggg
gagacacccgagctggccctggacccagtgcctcaggatgcgtccaccaagaggctgagc
gagtgtctcaagcgcatcggggacgaactggacagtaacatggagctgcagaggatgatt
gccgccgtggacacagactccccccgagaggtctttttccgagtggcagctgacatgttt
tctgacggcaacttcaactggggccgtgttgtcgcccttttctactttgccagcaaactg
gtgctcaaggccctgtgtaccaaggtgcccgaactgatcagaaccatcatgggctggaca
ctggacttcctccgggagcggctgttgggctggatccaagaccagggtggttgggacggc
ctcctctcctactttgggacgcccacgtggcagaccgtgaccatcttggtggctggagta
ctcaccgcctccctcaccatctggaagaagatgggctga

DBGET integrated database retrieval system