KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104666781
Entry
104666781         CDS       T03989                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04020  Calcium signaling pathway
rro04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104666781 (CACNA1E)
   04020 Calcium signaling pathway
    104666781 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    104666781 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104666781 (CACNA1E)
Ion channels [BR:rro04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   104666781 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 104666781
NCBI-ProteinID: XP_010367204
UniProt: A0A2K6P825
LinkDB
Position
8
AA seq 2313 aa
MARFGEAVVARPGSGDGDSDQSRNRQGTPVLGSGQAAAYKQTKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECKDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRT
EAMTRDSSDEHCVDISSVGTPLARASIKSAKVDGVSYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRKHMQMSSQEALNREEAPPMNPLNPLNPLSPLNPLNTHPSLYRRPRAIEGLALGL
ALEKFEEERISRGGSLKGDGGDRSSALDNQRTPLSLGQREPPWLARPCHGNCDPTQQEAG
GGEAVVTFEDRARHRQSQRRSRHRRVRTEGKESSSASRSRSASQERSLDEAMPTEGEKDP
ELRGNHGAKEPTIQEERAQDLRRTNSLMVSRGSGLAGGLDEANAPLVLPHPELEVGKDMV
PTEQEPEGSSEQALLGDVQLDMGRVISQSEPDLSCITANTDKATTESTSVTVAIPDVDPL
VDSTVVHISNKTDGEASPLKEAEIREDEEEVENKKQKKEKRETGKAMVPHSSMFIFSTTN
PIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFE
MVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRVL
RVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTD
SSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQH
SVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLE
KNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYY
SAPCTYELALKYLNIAFTMVFSLECVLKVIAFGFLNYFRDTWNIFDFITVIGSITEIILT
DSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFI
YAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEP
DTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHH
LDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAED
MTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKA
SDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALPY
LQQDPVSGLSGRSAYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLEPEVSELKSVQPSN
HGIYLPSDTQEHAGSGRASSMPRLTVDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEFSME
RSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDSHRSGGRERGRSKERKHLLSPDVSRC
NSEERGTQADWESPERRQSRSPSEGRSQTPNRQGTGSLSESSIPSVSDTSTPRRSRRQLP
PVPPKPRPLLSYSSLIRHAGSISPPADGSEEGSPLTSQALESNNACLTESSNSPHPQQSQ
HASPQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPN
GHYRRRRRGGPGPGMMCGAVNNLLSDTEEDDKC
NT seq 6942 nt   +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcgccaggccggggtccggcgatggagactcggac
cagagcaggaaccggcaaggaacccccgtgctgggctcggggcaggcggccgcctacaag
cagacgaaagcgcagagggcgcggactatggctttgtacaaccccattcccgtccggcag
aactgtttcaccgtcaacagatccctgttcatcttcggagaagataacattgtcaggaaa
tatgccaagaagctcatcgattggccgccatttgagtacatgatcctggccaccatcatt
gccaactgcatcgtcctggccctggagcagcatcttcctgaggacgacaagacccccatg
tcccgaagactggaaaagacagaaccttatttcattgggatcttttgctttgaagctggg
atcaaaattgtggccctggggttcatcttccataagggctcatacctccgcaatggctgg
aatgtcatggacttcatcgtggtcctcagtggcatcctggccactgcgggaacccacttc
aacactcatgtggacctgaggaccctccgggctgtgcgtgtcctgcggcccttgaagctc
gtgtcagggatacctagcctgcagattgttttgaagtccatcatgaaggccatggtacct
cttctgcagattggccttctactcttctttgccatcctgatgtttgctattattggcttg
gagttctacagtgggaagttacatcgagcatgcttcatgaacaattcaggtattctagaa
ggatttgacccccctcacccatgtggcgtgcagggctgcccagctggttatgaatgcaag
gactggatcggccccaatgatgggatcacccagtttgataacatcctttttgctgtgctg
actgtcttccagtgcatcaccatggaagggtggaccaccgtgttgtacaacaccaatgat
gccttaggagccacctggaattggctgtacttcatccccctcatcatcattggatccttc
tttgttctcaacctagtcctgggagtgctttccggggagtttgccaaagagagagagaga
gtggagaaccgaagggctttcatgaaactgcgacgccagcagcagattgagcgtgagctg
aatggctaccgtgcctggatagacaaagcagaggaagtcatgctcgctgaagaaaataaa
aatgctggaacatctgccttagaagtgcttcgaagggcaaccatcaagaggagccggaca
gaggccatgacccgagactccagcgatgagcactgtgttgatatctcctctgtgggcaca
cctctggcccgagccagtatcaaaagtgcaaaggtagacggggtctcttatttccggcac
aaggaaaggcttctgcgcatctccattcgccacatggttaaatcccaagtgttttactgg
attgtgctgagccttgtagcactcaacactgcctgtgtggccattgtccatcacaaccag
ccccagtggctcacccacctcctctactatgcagaatttctgtttctgggactcttcctc
ttggagatgtccctgaagatgtatggcatggggcctcgcctttattttcactcttcattc
aactgctttgattttggggtcacagtgggcagtatctttgaagtggtctgggcaatcttc
agacctggtacgtcttttggaatcagtgtcttgcgagccctccggcttctaagaatattt
aaaataaccaagtattgggcttccctgcggaatttggtggtctccttgatgagctcaatg
aagtcgatcatcagtttacttttcctcctcttcctcttcatcgttgtctttgctctccta
ggaatgcagttatttggtggcaggtttaactttaatgatgggactccttcggcaaatttt
gacaccttccctgcagccatcatgactgtgttccagatcctgacgggtgaggactggaat
gaggtgatgtacaatgggatccgctcccagggcggggtcagctcaggcatgtggtccgcc
atctacttcattgtgctcaccttgtttggcaactacacgctactgaatgtgttcttggct
atcgctgtagataatctggccaacgcccaggagctgaccaaggatgaacaggaggaagaa
gaggccttcaaccagaaacatgcactgcagaaggccaaggaggtcagcccgatgtctgca
cccaacatgccttcgatcgaaagagacagaaggagaagacaccacatgtcgatgtgggag
ccacgcagcagccacctgagggagcggaggcgccggcaccacatgtctgtgtgggagcag
cgcaccagccagctgaggaagcacatgcagatgtccagccaggaggccctcaacagggag
gaggcgccgcccatgaacccactcaaccccctcaacccactcagccccctcaacccactc
aacacacaccccagcctttatcggagacccagggccatcgagggcctggccctgggcctg
gccctggagaagttcgaggaggagcgcatcagccgtggggggtccctcaagggggatgga
ggggaccgatccagtgccctggacaaccagaggacccccttgtccctgggccagcgggag
ccgccgtggctggccaggccctgtcatgggaactgtgacccgactcagcaggaggcgggg
ggaggagaggctgtggtgacctttgaggaccgggccaggcacaggcagagccagcggcgc
agccggcatcgccgcgtcaggacggaaggcaaggagtcctcctcagcctctcggagcagg
tctgctagccaggaacgcagtctggatgaagccatgcccactgaaggggagaaggatcct
gagctcaggggcaaccatggtgccaaggagccaacgatccaagaagagagagcccaggat
ttaaggaggaccaacagtctgatggtgtccagaggctccgggctggcaggaggccttgat
gaggccaatgcccccttagtcctgccccatcctgagctggaagtggggaaggacatggtg
ccgacggagcaggagccggaaggtagcagtgagcaggccctgctgggggatgtgcagcta
gacatgggccgggtcatcagccagagtgagcccgacctctcctgcatcacggccaacacg
gacaaggccaccaccgagagcaccagcgtcactgtcgccatccccgacgtggaccccttg
gtggactcaaccgtggtgcacattagcaacaagacggatggggaagccagtcccttgaag
gaggcagagatcagagaggatgaggaggaggtggagaataagaagcagaagaaggagaag
cgcgagacaggcaaagccatggtgccccacagctccatgttcatcttcagcaccaccaac
ccgatccggagggcctgccactacatcgtgaacctgcgctactttgagatgtgcatcctc
ctggtgattgcagccagcagcatcgccctggcagcagaggaccccgtcctgaccaactca
gagcgcaacaaagtcctgaggtattttgactatgtgttcacgggcgtgttcacctttgag
atggttataaagatgatagaccaaggcttgatcctgcaggacgggtcctacttccgagac
ctgtggaacatcctggactttgtggtggtcgttggtgcattggtggcctttgctctggcg
aacgctttgggaaccaacaaaggacgggacatcaagaccatcaagtctctgcgggtgctc
cgagttctcaggccactgaaaaccatcaagcgcttgcccaagctcaaggctgtcttcgac
tgcgtggtgacctccttgaagaatgtcttcaacatactcattgtctacaagctcttcatg
ttcatctttgctgtcatcgcagttcagctcttcaagggaaagttcttttattgcacggac
agttccaaggacacagagaaggagtgcataggcaactatgtagatcatgagaaaaacaag
atggaggtgaagggccgggaatggaagcgccatgaattccactacgacaacattatctgg
gccctgctgaccctcttcaccgtctccacgggggaaggatggcctcaagttctgcagcac
tctgtagatgtgacagaggaagaccgaggcccaagccgcagcaaccgcatggagatgtct
attttttatgtggtctactttgtggtcttccctttcttcttcgtcaatatctttgtggct
ctcatcatcatcaccttccaggagcaaggggataagatgatggaggagtgcagcctggag
aagaatgagagggcgtgcatcgacttcgccatcagcgccaaacctctcacccgctacatg
ccgcagaacaggcacaccttccagtaccgcgtgtggcactttgtggtgtctccgtccttc
gaatacaccattatggccatgatcgccttgaataccgtcgtgctgatgatgaagtattac
tctgctccctgtacctatgagctggccctgaagtacctgaatatcgccttcaccatggtg
ttttccctggaatgcgtcctgaaggtcatcgcttttggctttttgaactatttccgagac
acctggaatatctttgacttcatcaccgtgattggcagtataacagaaattatcctgaca
gacagcaagctggtgaacaccagtggtttcaatatgagctttctgaagctcttccgagct
gcccgcctcataaagcttctgcgtcagggctataccatacgcattttgctgtggaccttt
gtgcagtcttttaaggccctcccttacgtctgccttttaattgccatgcttttcttcatt
tatgccatcattgggatgcaggtatttggaaacataaaattagatgaggagagtcacatc
aaccggcacaacaacttccggagtttctttgggtccctaatgctactcttcaggagtgcc
acaggtgaggcctggcaggagattatgctgtcatgcctcggggagaagggctgtgagcct
gacaccaccgcaccctcagggcagaacgagaacgagcgctgcggcaccgatctggcctac
gtgtactttgtctccttcatcttcttctgctccttcttgatgctcaacctgttcgtggcc
gtcatcatggacaactttgagtacctgactcgggactcctccatcctggggcctcaccac
ttggacgagtttgtccgcgtctgggcagaatatgaccgagcagcatgtggccgcatccat
tacactgagatgtatgaaatgctgactctcatgtcacctccgctaggcctcggcaagaga
tgtccctccaaagtggcatataagaggttggtcctgatgaacatgccagtagctgaggac
atgacggtccacttcacctccacacttatggctttgatccggacagctctggacattaaa
attgccaaaggtggtgcagacaggcagcagctagactcagagctacaaaaggagacccta
gccatctggcctcacctatcccagaagatgctggatctgcttgtgcccatgcccaaagcc
tctgacctgactgtgggcaaaatctatgcagcaatgatgatcatggactactataagcag
agtaaggtgaagaagcagaggcagcagctggaggaacagaaaaatgcccccatgttccaa
cgcatggagccctcatctctgcctcaggagatcattgctaatgccaaagccctgccttac
ctccagcaggaccccgtttcaggcctgagtggccggagtgcatacccttcgatgagtcca
ctctctccccaggagatattccagttggcttgtatggaccccgccgatgatggacagttc
caggaacagcagtctctggagccagaggttagtgaattaaaaagcgtgcagccctctaac
catggcatctaccttccttcggacacccaggagcatgcgggatctgggagggcatcctct
atgccacgtctgactgtggatccccaggtggtgacagaccccagctccatgagacgttca
ttttccactattcgggataagcgttcaaattcctcgtggttggaggaattctccatggag
cgaagcagtgaaaatacctacaagtcccgtcgccggagttaccactcctccttgcggctg
tcagcccaccgcctgaactctgattcaggccacaagtccgacagtcaccgctcagggggc
agggagcgaggacgatcaaaagagcgaaagcatcttctctctcctgatgtctcccgctgc
aattcagaagagcgagggacccaggctgactgggagtccccagagcgccgtcaatccagg
tcacccagtgagggcaggtcacagacgcccaacagacagggcacaggttccctaagtgag
agctccatcccctctgtctctgacaccagcaccccaagaagaagtcgtcggcagctcccg
cccgtcccaccaaagccccggcccctcctttcctacagctccctgattcgacacgcaggc
agcatctctccacctgctgatggaagcgaggagggctccccgctgacctcccaagccctg
gagagcaacaacgcttgcctgaccgagtcttccaactccccgcacccccagcagagccaa
catgcctccccgcagcgctacatctccgagccctacttggccctgcacgaagactcccac
gcctcagactgtggcgaggaggagacgctcacttttgaagcagccgtggctactagcctg
ggccgttccaacaccattggctcggccccacctctgcggcacagctggcagatgcccaat
gggcactatcggcgacggaggcgcggggggcctgggccaggcatgatgtgtggggctgtc
aacaacctgctaagtgacacggaagaagacgacaaatgctag

DBGET integrated database retrieval system