KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104666783
Entry
104666783         CDS       T03989                                 

Definition
(RefSeq) caspase-3-like
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01524  Platinum drug resistance
rro04010  MAPK signaling pathway
rro04115  p53 signaling pathway
rro04210  Apoptosis
rro04215  Apoptosis - multiple species
rro04650  Natural killer cell mediated cytotoxicity
rro04657  IL-17 signaling pathway
rro04668  TNF signaling pathway
rro04726  Serotonergic synapse
rro04932  Non-alcoholic fatty liver disease
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro05010  Alzheimer disease
rro05012  Parkinson disease
rro05014  Amyotrophic lateral sclerosis
rro05016  Huntington disease
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05133  Pertussis
rro05134  Legionellosis
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05210  Colorectal cancer
rro05222  Small cell lung cancer
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104666783
   04668 TNF signaling pathway
    104666783
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104666783
   04215 Apoptosis - multiple species
    104666783
   04115 p53 signaling pathway
    104666783
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104666783
   04657 IL-17 signaling pathway
    104666783
  09156 Nervous system
   04726 Serotonergic synapse
    104666783
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104666783
   05206 MicroRNAs in cancer
    104666783
   05205 Proteoglycans in cancer
    104666783
   05203 Viral carcinogenesis
    104666783
  09162 Cancer: specific types
   05210 Colorectal cancer
    104666783
   05222 Small cell lung cancer
    104666783
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104666783
   05012 Parkinson disease
    104666783
   05014 Amyotrophic lateral sclerosis
    104666783
   05016 Huntington disease
    104666783
   05020 Prion disease
    104666783
   05022 Pathways of neurodegeneration - multiple diseases
    104666783
  09166 Cardiovascular disease
   05416 Viral myocarditis
    104666783
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104666783
   04933 AGE-RAGE signaling pathway in diabetic complications
    104666783
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104666783
   05133 Pertussis
    104666783
   05134 Legionellosis
    104666783
   05152 Tuberculosis
    104666783
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104666783
   05161 Hepatitis B
    104666783
   05160 Hepatitis C
    104666783
   05164 Influenza A
    104666783
   05162 Measles
    104666783
   05168 Herpes simplex virus 1 infection
    104666783
   05163 Human cytomegalovirus infection
    104666783
   05167 Kaposi sarcoma-associated herpesvirus infection
    104666783
   05169 Epstein-Barr virus infection
    104666783
   05165 Human papillomavirus infection
    104666783
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104666783
   05145 Toxoplasmosis
    104666783
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104666783
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rro01002]
    104666783
Enzymes [BR:rro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     104666783
Peptidases and inhibitors [BR:rro01002]
 Cysteine peptidases
  Family C14: caspase family
   104666783
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 104666783
NCBI-ProteinID: XP_010367211
LinkDB
Position
8
AA seq 277 aa
MENTENSVDSKSIKSLELKTIHGSKSVNSGISLDNSYKMDYPEMGLCIIINSKNFHKSTG
MASRSGTDVDAANLRETFINLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLS
HGEEGIIFGTNGPLDLKKITSFFRGDCCRSLTGKPKLFIIRACRGTELDCGIETDSGVED
DMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAKLKQYPDKLEFMHILTRVN
RKVATEFESFSLDATFHAKKQIPCIVSMLTKELYFYH
NT seq 834 nt   +upstreamnt  +downstreamnt
atggagaacactgaaaactcagtggattcaaaatccattaaaagtttggaactaaaaacc
atacatggaagcaaatcagtgaactctggaatatccctggacaacagttataaaatggat
tatcctgagatgggtttatgtataataattaatagtaagaattttcataaaagcactgga
atggcatctcggtctggtacagatgttgatgcagcaaacctcagggaaacattcataaac
ttgaaatatgaagtcaggaataaaaacgatcttacacgtgaagaaattgtggaattgatg
cgtgatgtttctaaagaagatcacagcaaaaggagcagttttgtttgtgtgcttctgagc
catggtgaagaaggaataatttttggaacaaatggacctcttgacctgaaaaaaattaca
agctttttcagaggggattgttgtagaagtctaactggaaaacccaaacttttcattatt
cgggcctgccgtggtacagaactggactgtggcattgagacagacagtggtgttgaggat
gacatggcatgtcataaaatcccagtggaggccgacttcttgtatgcatactccacagca
cctggttattattcttggcgaaattcaaaggatggctcctggttcatccagtctctttgt
gccaagctgaaacagtaccccgacaagcttgaatttatgcacattcttacccgggttaac
cgaaaggtggcaacagaatttgagtccttttcccttgatgctacttttcatgcaaagaaa
cagattccatgtattgtttccatgctcacaaaagaactgtatttttatcactaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104673791
Entry
104673791         CDS       T03989                                 

Gene name
CASP3
Definition
(RefSeq) caspase-3
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01524  Platinum drug resistance
rro04010  MAPK signaling pathway
rro04115  p53 signaling pathway
rro04210  Apoptosis
rro04215  Apoptosis - multiple species
rro04650  Natural killer cell mediated cytotoxicity
rro04657  IL-17 signaling pathway
rro04668  TNF signaling pathway
rro04726  Serotonergic synapse
rro04932  Non-alcoholic fatty liver disease
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro05010  Alzheimer disease
rro05012  Parkinson disease
rro05014  Amyotrophic lateral sclerosis
rro05016  Huntington disease
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05133  Pertussis
rro05134  Legionellosis
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05210  Colorectal cancer
rro05222  Small cell lung cancer
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104673791 (CASP3)
   04668 TNF signaling pathway
    104673791 (CASP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104673791 (CASP3)
   04215 Apoptosis - multiple species
    104673791 (CASP3)
   04115 p53 signaling pathway
    104673791 (CASP3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104673791 (CASP3)
   04657 IL-17 signaling pathway
    104673791 (CASP3)
  09156 Nervous system
   04726 Serotonergic synapse
    104673791 (CASP3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104673791 (CASP3)
   05206 MicroRNAs in cancer
    104673791 (CASP3)
   05205 Proteoglycans in cancer
    104673791 (CASP3)
   05203 Viral carcinogenesis
    104673791 (CASP3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104673791 (CASP3)
   05222 Small cell lung cancer
    104673791 (CASP3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104673791 (CASP3)
   05012 Parkinson disease
    104673791 (CASP3)
   05014 Amyotrophic lateral sclerosis
    104673791 (CASP3)
   05016 Huntington disease
    104673791 (CASP3)
   05020 Prion disease
    104673791 (CASP3)
   05022 Pathways of neurodegeneration - multiple diseases
    104673791 (CASP3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    104673791 (CASP3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104673791 (CASP3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104673791 (CASP3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104673791 (CASP3)
   05133 Pertussis
    104673791 (CASP3)
   05134 Legionellosis
    104673791 (CASP3)
   05152 Tuberculosis
    104673791 (CASP3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104673791 (CASP3)
   05161 Hepatitis B
    104673791 (CASP3)
   05160 Hepatitis C
    104673791 (CASP3)
   05164 Influenza A
    104673791 (CASP3)
   05162 Measles
    104673791 (CASP3)
   05168 Herpes simplex virus 1 infection
    104673791 (CASP3)
   05163 Human cytomegalovirus infection
    104673791 (CASP3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104673791 (CASP3)
   05169 Epstein-Barr virus infection
    104673791 (CASP3)
   05165 Human papillomavirus infection
    104673791 (CASP3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104673791 (CASP3)
   05145 Toxoplasmosis
    104673791 (CASP3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104673791 (CASP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rro01002]
    104673791 (CASP3)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     104673791 (CASP3)
Peptidases and inhibitors [BR:rro01002]
 Cysteine peptidases
  Family C14: caspase family
   104673791 (CASP3)
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 104673791
NCBI-ProteinID: XP_010376231
UniProt: A0A2K6PL28
LinkDB
Position
2
AA seq 277 aa
MENTENSVDSKSIKSLELKTIHGSKSVDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTG
MASRSGTDVDAANLRETFINLKYEVRNKNDLTREEIVELMRNVSKEDHSKRSSFVCVLLS
HGEEGIIFGTNGPLDLKKITSFFRGDCCRSLTGKPKLFIIQACRGTELDCGIETDSGVED
DMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYANKLEFMHILTRVN
RKVATEFESFSLDATFHAKKQIPCIVSMLTKELYFYH
NT seq 834 nt   +upstreamnt  +downstreamnt
atggagaacactgaaaactcagtggattcaaaatccattaaaagtttggaactaaaaacc
atacatggaagcaaatcagtggactctggaatatccctggacaacagttataaaatggat
tatcctgagatgggtttatgtataataattaataataagaattttcataaaagcactgga
atggcatctcggtctggtacagatgttgatgcagcaaacctcagggaaacattcataaac
ttgaaatatgaagtcaggaataaaaacgatcttacacgtgaagaaattgtggaattgatg
cgtaatgtttctaaagaagatcacagcaaaaggagcagttttgtttgtgtgcttctgagc
catggtgaagaaggaataatttttggaacaaatggacctcttgacctgaaaaaaattaca
agctttttcagaggggattgttgtagaagtctaactggaaaacccaaacttttcattatt
caggcctgccgtggtacagaactggactgtggcattgagacagacagtggtgttgaggat
gacatggcatgtcataaaatcccagtggaggccgacttcttgtatgcatactccacagca
cctggttattattcttggcgaaattcaaaggatggctcctggttcatccagtcgctttgt
gccatgctgaaacagtacgccaacaagcttgaatttatgcacattcttacccgggttaac
cgaaaggtggcaacagaatttgagtccttttcccttgatgctacttttcatgcaaagaaa
cagattccatgtattgtttccatgctcacaaaagaactgtatttttatcactaa

DBGET integrated database retrieval system