KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104666852
Entry
104666852         CDS       T03989                                 

Gene name
CRKL
Definition
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04015  Rap1 signaling pathway
rro04062  Chemokine signaling pathway
rro04510  Focal adhesion
rro04666  Fc gamma R-mediated phagocytosis
rro04722  Neurotrophin signaling pathway
rro04810  Regulation of actin cytoskeleton
rro04910  Insulin signaling pathway
rro04935  Growth hormone synthesis, secretion and action
rro05100  Bacterial invasion of epithelial cells
rro05135  Yersinia infection
rro05163  Human cytomegalovirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05206  MicroRNAs in cancer
rro05211  Renal cell carcinoma
rro05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104666852 (CRKL)
   04012 ErbB signaling pathway
    104666852 (CRKL)
   04015 Rap1 signaling pathway
    104666852 (CRKL)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104666852 (CRKL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104666852 (CRKL)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    104666852 (CRKL)
   04062 Chemokine signaling pathway
    104666852 (CRKL)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104666852 (CRKL)
   04935 Growth hormone synthesis, secretion and action
    104666852 (CRKL)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104666852 (CRKL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104666852 (CRKL)
   05206 MicroRNAs in cancer
    104666852 (CRKL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    104666852 (CRKL)
   05211 Renal cell carcinoma
    104666852 (CRKL)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104666852 (CRKL)
   05100 Bacterial invasion of epithelial cells
    104666852 (CRKL)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104666852 (CRKL)
   05163 Human cytomegalovirus infection
    104666852 (CRKL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rro04990]
    104666852 (CRKL)
Domain-containing proteins not elsewhere classified [BR:rro04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   104666852 (CRKL)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 hSH3
Other DBs
NCBI-GeneID: 104666852
NCBI-ProteinID: XP_010367285
UniProt: A0A2K6RHN4
LinkDB
Position
13
AA seq 303 aa
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPT
AEDNLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPD
ENE
NT seq 912 nt   +upstreamnt  +downstreamnt
atgtcctccgccaggttcgactcctcggaccgctccgcctggtacatggggccggtgtct
cgccaggaggcgcagacccggctccagggccagcgccacggtatgttcctcgtccgcgat
tcttccacctgccctggggactatgtgctgtcggtgtccgagaactcgcgagtctcccac
tacatcatcaactcgctgcccaaccgccgttttaagatcggggaccaggagtttgaccat
ttgccggccctgctggagttttacaagatccactacctggacaccaccaccctcatcgaa
cccgcgcccaggtatccaagcccaccaatgggctctgtctcagcacccaacctgcctaca
gcagaagataacctggaatatgtacggactctgtatgattttcctggaaatgatgccgaa
gacctgccctttaaaaagggtgagatcctagtgataatagagaagcctgaagaacagtgg
tggagtgcccgaaacaaggatggccgggttgggatgattcctgtcccttatgtcgaaaag
cttgtgagatcctcaccacacggaaagcatggaaataggaattccaacagttatgggatc
ccagaacctgctcatgcatacgctcaacctcagaccacaactcctctacctgcagtttcc
ggttctcctggggcagcaatcacccctttgccatccacacagaatggacctgtctttgcg
aaagcaatccagaaaagagtaccctgtgcttatgacaagactgccttggcattagaggtt
ggtgacatcgtgaaagtcacaaggatgaatataaatggccagtgggaaggcgaggtgaat
gggcgcaaagggctttttccctttacgcatgtcaaaatctttgaccctcaaaacccagat
gaaaacgagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670311
Entry
104670311         CDS       T03989                                 

Gene name
CRK
Definition
(RefSeq) adapter molecule crk isoform X1
  KO
K04438  C-crk adapter molecule crk
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04015  Rap1 signaling pathway
rro04062  Chemokine signaling pathway
rro04510  Focal adhesion
rro04666  Fc gamma R-mediated phagocytosis
rro04722  Neurotrophin signaling pathway
rro04810  Regulation of actin cytoskeleton
rro04910  Insulin signaling pathway
rro04935  Growth hormone synthesis, secretion and action
rro05100  Bacterial invasion of epithelial cells
rro05135  Yersinia infection
rro05163  Human cytomegalovirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05206  MicroRNAs in cancer
rro05211  Renal cell carcinoma
rro05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104670311 (CRK)
   04012 ErbB signaling pathway
    104670311 (CRK)
   04015 Rap1 signaling pathway
    104670311 (CRK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104670311 (CRK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104670311 (CRK)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    104670311 (CRK)
   04062 Chemokine signaling pathway
    104670311 (CRK)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104670311 (CRK)
   04935 Growth hormone synthesis, secretion and action
    104670311 (CRK)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104670311 (CRK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104670311 (CRK)
   05206 MicroRNAs in cancer
    104670311 (CRK)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    104670311 (CRK)
   05211 Renal cell carcinoma
    104670311 (CRK)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104670311 (CRK)
   05100 Bacterial invasion of epithelial cells
    104670311 (CRK)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104670311 (CRK)
   05163 Human cytomegalovirus infection
    104670311 (CRK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rro04990]
    104670311 (CRK)
Domain-containing proteins not elsewhere classified [BR:rro04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   104670311 (CRK)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10 DUF3804
Other DBs
NCBI-GeneID: 104670311
NCBI-ProteinID: XP_010371797
UniProt: A0A2K6Q388
LinkDB
Position
19
AA seq 304 aa
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcgggcaacttcgactcggaggagcggagtagctggtactgggggcggttgagtcgg
caggaggcggtggcgctgctgcagggccagcggcacggggtgttcctggtgcgggactcg
agcaccagccccggggactatgtgctcagcgtctcagagaactcgcgcgtctcccactac
atcatcaacagcagcggcccgcgcccgccagtgccaccgtcgcccgcccaacctccgccc
ggggtgagcccctccagactccgaataggagatcaagagtttgattcattgcctgcttta
ctggaattctacaaaatacactatttggacactacaacgttgatagaaccggtttccaga
tccaggcagggtagtggagtgattctcaggcaggaggaggcggagtatgtgcgagccctc
tttgactttaatgggaatgatgaggaagatcttccctttaagaaaggagacatcttgaga
atccgggacaagcctgaagagcagtggtggaatgcggaggacagcgaaggcaagagaggg
atgattccagtcccttacgtcgagaagtatagacctgcctccgcctcagtatcggctctg
attggaggtaaccaggagggttcccacccacagccactgggtgggccggagcctgggccc
tatgcccaacccagcgtcaacactccgctccctaacctccagaatgggcccatatatgcc
agggttatccagaagcgagtccccaatgcctacgacaagacagccttggctttggaggtc
ggtgagctggtaaaggttacgaagattaatgtgagtggtcagtgggaaggggagtgtaat
ggcaaacgaggtcacttcccattcacacatgtccgtctgctggatcaacagaatcccgat
gaggacttcagctga

DBGET integrated database retrieval system