KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104666941
Entry
104666941         CDS       T03989                                 

Gene name
NKX2-2
Definition
(RefSeq) homeobox protein Nkx-2.2
  KO
K08029  homeobox protein Nkx-2.2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:rro00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    104666941 (NKX2-2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104666941 (NKX2-2)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: NKL
    104666941 (NKX2-2)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 104666941
NCBI-ProteinID: XP_010367402
UniProt: A0A2K6R2L3
LinkDB
Position
13
AA seq 273 aa
MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLP
LKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPG
GGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHR
YKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQ
SLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW
NT seq 822 nt   +upstreamnt  +downstreamnt
atgtcgctgaccaacacaaagacggggttttcggtcaaggacatcttagacctgccggac
accaacgatgaggagggctctgtggccgaagggccggaggaagagaacgaggggcccgaa
ccagccaagagggccgggccgctggggcagggcgccctggacgcggtgcagagcctgccc
ctgaagaaccccttctacgacagcagcgacaacccgtacacgcgctggctggccagcacc
gagggcctccagtactccctgcacggtctggcggcaggcgcgccccctcaggactcaagc
tccaagtccccggagccctcggccgacgagtcaccggacaatgacaaggagaccccgggc
ggcgggggggacgctggcaagaagcggaagcggcgggtgcttttctccaaggcgcagacc
tacgagctggagcggcgctttcggcagcagcggtacctgtcggcgcccgagcgcgagcac
ctggctagcctcattcgcctcacgcccacgcaggtcaagatctggttccagaaccaccgc
tacaagatgaagcgcgcccgggccgagaaaggtatggaggtgacgcccctgccctcgccg
cgccgggtggctgtgcccgtcttggtcagggacggcaaaccgtgccacgcgctcaaagcc
caggacctggcagccgccaccttccaggcgggcattcccttttcggcctacagcgcgcag
tcgctgcagcacatgcagtacaacgcccagtacagctcggccagcaccccccagtacccg
acagcacaccccctggtccaggcccagcagtggacttggtga

DBGET integrated database retrieval system