KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104666943
Entry
104666943         CDS       T03989                                 

Gene name
NKX2-4
Definition
(RefSeq) homeobox protein Nkx-2.4
  KO
K09344  homeobox protein Nkx-2.4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104666943 (NKX2-4)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: NKL
    104666943 (NKX2-4)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 104666943
NCBI-ProteinID: XP_030769783
LinkDB
Position
13
AA seq 356 aa
MSLSPKHTTPFSVSDILSPIEETYKKFGGAMDGAPPGLGAPLGAAAAAAYRAPPPGPSSQ
AATVAGMQPPHAMAGHNAAAAAAAAAAAAAAAATYHMPPGVSQFPHGAMGGYCNGGLGNM
GELPAYTDGMRGGAATGWYGANPDPRYSSISRFMGPSAGVNVAGMGSLTGIADAAKSLAP
LHAAAAAAAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQ
NHRYKMKRQAKDKAAQQLQQEGGLGPPPPPPPSPRRVAVPVLVKDGKPCQNGASTPTPGQ
AGAQPPAPTPAPELEELSPSPPALHGPGGGLAALDPAAGEYGGGVLGANLLYGRTW
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgtcgttgagcccaaagcacacgacgcccttctccgtgtccgacatcctgagccccatc
gaggagacctacaagaagttcggcggcgccatggacggcgcgccacccggcctgggggcg
cccctgggggccgcggccgccgccgcctaccgcgcgccgccacccgggccctcctcgcag
gcggcaaccgtggcaggcatgcagccccctcacgccatggcgggtcacaacgcggcggcc
gcggcggcggcggcggcagcggcggcggcggcggccgccacctaccacatgccgcctggc
gtctcgcagttcccgcacggcgccatgggtggctactgcaacggcggcctgggcaacatg
ggcgagctgcccgcctacacggacggcatgcggggcggcgcggccaccggctggtacggc
gccaacccggacccacgctactcgtcaatctccaggttcatggggccgtcggcgggcgtg
aatgtggccggcatggggtcgctgacgggcatcgcggacgccgccaagtcgctggcgccg
ctgcacgcggcggcggcggcagccgctccgcgaaggaagcgccgcgtgctcttctcgcag
gcgcaggtctacgagctggagcggcgcttcaagcagcagaagtacctgtcggcgccggag
cgcgagcacctggccagcatgatccacctgacgcccacgcaggtcaagatctggttccag
aaccaccgctacaagatgaaacggcaggccaaggacaaggcggcgcagcagctgcagcag
gagggtggcctgggcccgccgccgcctccgccgccgtccccgcgccgcgtggctgtgccc
gtgctggtcaaggacggcaagccgtgccagaacggtgccagcacgcccacccctggccag
gccggtgcgcagccgccggccccgacgcccgcgcctgagctggaggagctgtcgcccagc
ccaccggcgctgcacggcccggggggcggcctggcggccctggacccggccgccggggag
tacggcggtggtgtcctgggcgccaacctgctctatggcaggacgtggtga

DBGET integrated database retrieval system