KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104666954
Entry
104666954         CDS       T03989                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04014  Ras signaling pathway
rro04390  Hippo signaling pathway
rro04392  Hippo signaling pathway - multiple species
rro05200  Pathways in cancer
rro05206  MicroRNAs in cancer
rro05219  Bladder cancer
rro05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    104666954 (RASSF1)
   04390 Hippo signaling pathway
    104666954 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    104666954 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104666954 (RASSF1)
   05206 MicroRNAs in cancer
    104666954 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    104666954 (RASSF1)
   05223 Non-small cell lung cancer
    104666954 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1
Other DBs
NCBI-GeneID: 104666954
NCBI-ProteinID: XP_010367423
LinkDB
Position
1
AA seq 474 aa
MSAEPELIELRELAPAGRAGQGRTRLERANALRIARGTTCNPARQLVPGRGHRFQPAGPA
THTWCDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPRDLGWEPAVERDTNVV
GSLSGAAGAMRSFLEAKCACPRPGVPPSMTQELVPGDLRFSLNGCGAALGQAHAHTDTRT
RTHATGAVVGGYGRAGPGGRAGAAMGEAETPSFEMTWSSTTSSGYCSQEDSDSELEQYFT
ARTSLARRPRRDQDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKV
QLKLVRPVSVPSSKKPPSLQDARRGPGRSTSVRRRTSFYLPKDAVKHLHVLSRTRAREVI
EALLRKFLVVDDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALTFVLKEN
DSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgtcggcggagcctgagctcattgagctgcgggagctggcacctgctgggcgcgctggg
cagggccgcacccggctggagcgtgccaacgcgctgcgcatcgcgcggggtaccacgtgc
aaccccgcacggcagctggtcccgggccgtggccaccgcttccagcccgccgggcccgcc
acgcacacgtggtgcgacctctgtggcgacttcatctggggcgtagtgcgcaagggcctg
cagtgcgcgcattgcaagttcacctgccactaccgctgccgcgcgctcgtctgcctggac
tgctgcgggccccgggacctgggctgggaacccgcggtggagcgggacacgaacgtggtg
gggtctctgagtggagctgccggagcgatgaggtcattcctcgaagctaagtgtgcgtgt
ccccgccccggcgttcctccctcaatgacacaagagctagttcccggcgatctacgtttc
agtcttaacggttgcggcgcggcgctgggccaggcgcacgcgcacactgacacgcgtaca
cgcacgcacgcgaccggggcggtggttggcggctacggacgcgcgggaccagggggacgg
gcgggtgcggcgatgggcgaggcggagacgccttctttcgagatgacctggagcagcacg
acgagcagtggctactgcagccaagaggactcagactcggagctcgagcagtacttcacc
gcgcgaacctcgctagcgcgcaggccgcgccgggaccaggatgagcctgtggagtgggag
acacctgacctttctcaagctgagattgagcagaagatcaaggagtacaatgcccagatc
aatagcaacctcttcatgagcttgaacaaggacggttcttacacaggcttcatcaaggtt
cagctgaagctggtgcgccctgtctctgtgccctccagcaagaagccaccctccttgcag
gatgcccggcggggcccaggacggagcacaagtgtcaggcgccgcacttccttttacctg
cccaaggatgctgtcaagcacctgcatgtgctgtcacgcacaagggcacgtgaagtcatt
gaggccctgctgcgaaagttcttggtggtggatgacccccgcaagtttgcactctttgag
cgggctgagcgtcacggccaagtgtacttgcgaaagctgttggatgatgagcagcccctg
cggctgcggctcctggcagggcccagtgacaaggccctgaccttcgtcctgaaggaaaat
gactctggggaggtgaactgggacgccttcagcatgcctgaactacataacttcctgcgt
atcctgcagcgggaggaggaggagcacctccgccagatcctgcagaagtactcctattgc
cgccagaagatccaagaggccctgcacgcctgccccctcgggtga

DBGET integrated database retrieval system