KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104667046
Entry
104667046         CDS       T03989                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01523  Antifolate resistance
rro04010  MAPK signaling pathway
rro04014  Ras signaling pathway
rro04062  Chemokine signaling pathway
rro04064  NF-kappa B signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04210  Apoptosis
rro04380  Osteoclast differentiation
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04623  Cytosolic DNA-sensing pathway
rro04625  C-type lectin receptor signaling pathway
rro04657  IL-17 signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04668  TNF signaling pathway
rro04920  Adipocytokine signaling pathway
rro05132  Salmonella infection
rro05135  Yersinia infection
rro05142  Chagas disease
rro05145  Toxoplasmosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05212  Pancreatic cancer
rro05215  Prostate cancer
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05222  Small cell lung cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05340  Primary immunodeficiency
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104667046 (IKBKG)
   04014 Ras signaling pathway
    104667046 (IKBKG)
   04064 NF-kappa B signaling pathway
    104667046 (IKBKG)
   04668 TNF signaling pathway
    104667046 (IKBKG)
   04151 PI3K-Akt signaling pathway
    104667046 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104667046 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104667046 (IKBKG)
   04621 NOD-like receptor signaling pathway
    104667046 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    104667046 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    104667046 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    104667046 (IKBKG)
   04660 T cell receptor signaling pathway
    104667046 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    104667046 (IKBKG)
   04659 Th17 cell differentiation
    104667046 (IKBKG)
   04657 IL-17 signaling pathway
    104667046 (IKBKG)
   04662 B cell receptor signaling pathway
    104667046 (IKBKG)
   04062 Chemokine signaling pathway
    104667046 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    104667046 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104667046 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104667046 (IKBKG)
   05203 Viral carcinogenesis
    104667046 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104667046 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    104667046 (IKBKG)
   05221 Acute myeloid leukemia
    104667046 (IKBKG)
   05220 Chronic myeloid leukemia
    104667046 (IKBKG)
   05215 Prostate cancer
    104667046 (IKBKG)
   05222 Small cell lung cancer
    104667046 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    104667046 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104667046 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104667046 (IKBKG)
   05135 Yersinia infection
    104667046 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104667046 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    104667046 (IKBKG)
   05162 Measles
    104667046 (IKBKG)
   05164 Influenza A
    104667046 (IKBKG)
   05161 Hepatitis B
    104667046 (IKBKG)
   05160 Hepatitis C
    104667046 (IKBKG)
   05168 Herpes simplex virus 1 infection
    104667046 (IKBKG)
   05163 Human cytomegalovirus infection
    104667046 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104667046 (IKBKG)
   05169 Epstein-Barr virus infection
    104667046 (IKBKG)
   05165 Human papillomavirus infection
    104667046 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104667046 (IKBKG)
   05142 Chagas disease
    104667046 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    104667046 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104667046 (IKBKG)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   104667046 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 Bacillus_HBL LLC1
Other DBs
NCBI-GeneID: 104667046
NCBI-ProteinID: XP_010367530
UniProt: A0A2K6ND13
LinkDB
Position
7
AA seq 419 aa
MSRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE
LRDAIRQSNQMLRERCEELLHFQASQREEKEFLMCKFQEARKLVERLSLEKLNLKRQKEQ
ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQTLEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHIKSSLVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH
VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagcaggcacctctggaagagccaactgtgtgagatggtgcaacccagtggtggcccg
gcagcagatcaggacgtgctgggtgaagagtctcctctggggaagccagccatgctgcac
ctgccttcagagcagggcgctcctgagactctccagcgctgcctggaggagaatcaagag
ctccgagatgccatccggcagagcaaccagatgctgcgagagcgctgcgaggagcttctg
catttccaagccagccagagggaggagaaggagttcctcatgtgcaaattccaagaggcc
aggaaactggtggagagactcagcctggagaagctcaacctgaagaggcagaaagagcag
gctctgcgggaggtagagcacctgaagagatgccagcagcagatggctgaggacaaggcc
tctgtgaaagcccaggtgacatccttgctcggggagctgcaggagagccagagtcgcttg
gaggctgccactaaggaatgccagactctggagggtcgggcccgggcggccagcgagcag
gcgcggcagctggagagtgagcgcgaggcactgcagcagcagcacagcgtgcaggtggac
cagctgcgcatgcagggccagagcgtggaggccgcactccgcatggagcgccaggctgcc
tcggaggagaagcggaagctggcccagttgcaggtggcctatcaccagctcttccaagaa
tacgacaaccacatcaagagcagcctggtgggcagcgagcggaagcgaggaatgcagctg
gaagatctcaaacagcagctccagcaggctgaagaggccctggtggccaaacaggaggtg
atcgataagctgaaggaggaggccgagcagcacaagattgtgatggagaccgttccggtg
ctgaaggcccaggcggacatctacaaggcggacttccaggctgagaggcaggctcgggag
aagctggccgagaagaaggagctcttgcaggagcagctggagcagctgcagagggagtac
agcaaactgaaggccagctgtcaggagtcggccaggatcgaggacatgaggaagcggcat
gttgaggtctcccaggcccccttgccccccgcccccgcctacctctcctctcccctggcc
ctgcccagccagaggaggagcccccctgaggagccacctgacttctgctgtcccaagtgc
cagtatcaggcccctgatatggacaccctgcagatacatgtcatggagtgcattgagtag

DBGET integrated database retrieval system