KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104667244
Entry
104667244         CDS       T03989                                 

Definition
(RefSeq) prostate-specific antigen isoform X2
  KO
K01351  semenogelase [EC:3.4.21.77]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro05200  Pathways in cancer
rro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104667244
  09162 Cancer: specific types
   05215 Prostate cancer
    104667244
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rro01002]
    104667244
Enzymes [BR:rro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.77  semenogelase
     104667244
Peptidases and inhibitors [BR:rro01002]
 Serine peptidases
  Family S1: chymotrypsin family
   104667244
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 104667244
NCBI-ProteinID: XP_010367870
UniProt: A0A2K6QPG3
LinkDB
Position
12
AA seq 238 aa
MWVLVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASHGRAVCGGVLVHPQWV
LTAAHCIRSNSVILLGRHNLFHPEDTGQVFQVSHSFPHPLYNMSLLKNQFLRPGDDSSHD
LMLLRLSEPAEITDAVKVLDLPAWEPALGTTCYASGWGSIEPEEYLTPKKLQCVDLRIIS
NDVCAQVHFQKVTEFMLCAGSWMGGKSTCSWVILITELTMPALLTALHDSPVPWRGGV
NT seq 717 nt   +upstreamnt  +downstreamnt
atgtgggtcctggttgtcttcctcaccctgtccgtgacgtggattggcgctgcacccctc
atcctgtctcggattgtgggaggctgggagtgcgagaagcattcccaaccctggcaggtg
cttgtggcctctcatggcagggcagtctgcgggggtgttctggtgcacccccagtgggtc
ctcacagctgcccactgcatcaggagcaacagcgtgatcttgctgggtcggcacaacctg
tttcatcctgaagatacgggccaggtatttcaggtcagccacagcttcccacacccgctc
tacaacatgagccttctgaagaatcagttcctcaggccaggtgatgactccagccacgac
ctcatgctgctccgcctgtcagagcctgccgagatcacagatgctgtgaaggtcctggac
ctgcccgcctgggagccagcactggggaccacgtgctacgcctcaggctggggcagcatc
gaaccggaggagtacttgactccaaagaaacttcagtgtgtggacctccgtattatttcc
aatgatgtgtgtgcgcaagttcactttcagaaggtgaccgagttcatgctgtgtgctgga
agctggatgggcggtaaaagcacctgttcgtgggtcattctgatcactgaactgaccatg
ccagccctgctcacggccctccatgactccccagtgccctggagaggaggtgtctag

DBGET integrated database retrieval system