KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104667323
Entry
104667323         CDS       T03989                                 

Gene name
DAG1
Definition
(RefSeq) dystroglycan
  KO
K06265  dystroglycan 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04512  ECM-receptor interaction
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104667323 (DAG1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104667323 (DAG1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104667323 (DAG1)
   05414 Dilated cardiomyopathy
    104667323 (DAG1)
   05416 Viral myocarditis
    104667323 (DAG1)
SSDB
Motif
Pfam: DAG1 a_DG1_N2 He_PIG VasL ATP1G1_PLM_MAT8
Other DBs
NCBI-GeneID: 104667323
NCBI-ProteinID: XP_010367983
UniProt: A0A2K6RBL8
LinkDB
Position
1
AA seq 894 aa
MRMSVGLSLLLPLWGMAQILLSVAMAQSHWPSEPSEAVRDWDNQLEASMHSVLSDLHEAV
PTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDPQSHTLEGLP
LDTDKGVHYISVSAARLGANGSHIPQTSCVFSIEVYPEDHSELQSVRTAFPDPGEVVSSA
CAVDEPVTVLTVILDADLTKMTPKQRIDLLHRMRSFSEVELHNMKLVPVVNNRLFDMSAF
MAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIRGVEAPAREGAMSAQLGYPVVGWHIAN
KKPPLPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDP
VPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTMTIPGYVEPTAVATPPT
TTTKKPRVSTPKPATPSTDSSTTTTRRPTKKPRTPRPVPRVTTKVPITRLETASPPTRIR
TTTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDHEDTTTDKLKLTLKLR
EQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQG
DRAPARFKAKFVGDPALVLNDIHKKIALVKKLAFAFGDRNCSTVTLQNITRGSIVVEWTN
NTLPLEPCPKEQIAGLSRRIAEDDGKPRPAFSNALEPDFKATSIAVMGSGSCRHLQFIPV
APPRRVPSEAPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKG
KLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETTP
LNQDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
NT seq 2685 nt   +upstreamnt  +downstreamnt
atgagaatgtctgtgggcctctcgctgctgctccccctctgggggatggcacaaatcctg
ctctctgtggctatggctcagtcccactggcccagtgaaccctcagaggctgtcagggac
tgggataaccagcttgaggcatccatgcactcagtgctctcagacctccacgaggctgtt
cccacagtggttggcattcctgatggcacggctgtcgtcgggcgctcatttcgagtgacc
attccaacagatttgattgcctccagtggagacatcatcaaggtatcagcagcagggaag
gaggctttgccatcttggctgcactgggacccgcagagccacaccctggagggcctcccc
cttgacactgataagggtgtgcattacatttcggtgagcgctgcacggctgggtgccaac
gggagccacatcccccagacctcctgtgtgttctccattgaggtctaccctgaagaccac
agtgagctgcagtcagtgaggacagccttcccagaccctggtgaggtggtatcatctgcc
tgtgctgtggatgaacctgtgactgttttgacggtgattttggatgccgacctcaccaag
atgaccccaaagcaaaggattgacctcctgcacaggatgcggagcttctcagaagtagag
cttcacaacatgaaattagtgccggtggtgaataacagactatttgacatgtcggccttc
atggctggcccgggaaatgcaaaaaaggtggtggagaatggggcccttctctcctggaag
ctgggctgctccctgaaccagaacagtgtgcctgacattcgtggtgtggaggctcctgcg
agggagggtgctatgtctgctcagcttggctaccctgtggtgggttggcacatcgccaat
aagaaaccccctcttcccaaacgcatccggaggcagatccatgccacacccacacctgtc
actgccattgggcccccaaccacggctatccaggagcccccatccaggatcgtgccaaca
cccacatctccagccattgctcctccgacagagaccatggctcctccagtcagggatcct
gttcctgggaaacccacagtcaccatccggactcgaggcgccattattcagaccccaacc
ctaggccccatccagcctactcgggtgtcagaagctggcaccacagttcctggccagatt
cgcccaacaatgaccattcctggctatgtggagcctactgcagttgctacccctcccaca
accaccaccaagaagccacgagtatccacaccaaaaccagcaacgccttcaactgactct
tccaccaccacgactcgcaggccaaccaagaaaccacggacaccccggccagtgccccgg
gtcaccaccaaagttcctatcaccagattagaaactgcctcaccgcctactcgtattcgc
accaccaccagtggagtgccccgtggcggagaacccaaccagcgcccagagctcaagaac
catattgacagggtagatgcctgggttggcacctattttgaggtgaagatcccgtcagac
actttctacgaccatgaggacaccaccactgacaagctgaagctgaccctgaaactgcgg
gagcagcagctggtgggtgagaagtcctgggtacagttcaacagcaacagccagctcatg
tatggccttcccgacagcagccacgtgggcaaacacgagtatttcatgcatgccacagac
aaggggggcctgtcggctgtggatgccttcgagatccacgtccacaggcgcccccaaggg
gatagggctcctgcaaggttcaaggccaagtttgtgggtgacccggcactggtgttaaat
gacatccacaagaagattgccttggtaaagaaactggccttcgcctttggagaccgaaac
tgtagcaccgtcaccctgcagaatatcacccggggctccatcgtggtggaatggaccaac
aacacactgcccttggagccctgccccaaggagcagatcgctgggctgagccgccggatc
gctgaggatgatggaaaacctcggcctgccttctccaacgccttagagcctgactttaag
gccacaagcatcgctgtgatgggctctggcagttgtcggcacctacagtttatccctgtg
gcaccacccaggagagtgccctcagaggcgccgcccacagaggtgcctgacagggaccct
gagaagagcagtgaggatgatgtctacctgcacacagtcattccggccgtggtggtcgca
gccatcctactcattgctggcatcattgccatgatctgctaccgcaagaagcgtaagggc
aagcttacccttgaggaccaggccaccttcatcaagaagggggtgcctatcatctttgcg
gacgaactggacgactccaagcccccgccctcctccagcatgccactcattctgcaggag
gagaaggctcccctaccccctcccgagtaccccaaccagagtgtgcccgagaccactcct
ctgaaccaggacactgtgggagagtacacgcccctgcgggatgaggatcccaatgcgcct
ccctaccagcccccaccgcccttcacagcacccatggagggcaagggctcccgtcctaag
aacatgaccccataccggtcacctcctccctatgtccctccttaa

DBGET integrated database retrieval system