KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104667362
Entry
104667362         CDS       T03989                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A isoform X1
  KO
K05448  vascular endothelial growth factor A
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro04010  MAPK signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04066  HIF-1 signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04370  VEGF signaling pathway
rro04510  Focal adhesion
rro04926  Relaxin signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05219  Bladder cancer
rro05323  Rheumatoid arthritis
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104667362 (VEGFA)
   04014 Ras signaling pathway
    104667362 (VEGFA)
   04015 Rap1 signaling pathway
    104667362 (VEGFA)
   04370 VEGF signaling pathway
    104667362 (VEGFA)
   04066 HIF-1 signaling pathway
    104667362 (VEGFA)
   04020 Calcium signaling pathway
    104667362 (VEGFA)
   04151 PI3K-Akt signaling pathway
    104667362 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104667362 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    104667362 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104667362 (VEGFA)
   05206 MicroRNAs in cancer
    104667362 (VEGFA)
   05205 Proteoglycans in cancer
    104667362 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    104667362 (VEGFA)
   05211 Renal cell carcinoma
    104667362 (VEGFA)
   05219 Bladder cancer
    104667362 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    104667362 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104667362 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104667362 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104667362 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104667362 (VEGFA)
   05165 Human papillomavirus infection
    104667362 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104667362 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104667362 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104667362 (VEGFA)
Cytokines and growth factors [BR:rro04052]
 Growth factors
  Growth factors (RTK binding)
   104667362 (VEGFA)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   104667362 (VEGFA)
SSDB
Motif
Pfam: VEGF_C PDGF
Other DBs
NCBI-GeneID: 104667362
NCBI-ProteinID: XP_010368048
LinkDB
Position
4
AA seq 215 aa
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM
SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQ
DPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaactttctgctctcttgggtgcattggagccttgccttgctgctgtacctccaccat
gccaagtggtcccaggctgcacccatggcagaaggaggagggcagaatcatcacgaagtg
gtgaagttcatggatgtctatcagcgcagctactgccatccaatcgagaccctggtggac
atcttccaggagtaccctgatgagattgagtacatcttcaagccatcctgtgtgcccctg
atgcgatgtgggggctgctgcaatgacgagggcctggagtgtgtgcccactgaggagtcc
aacatcaccatgcagattatgcggatcaaacctcaccaaggccagcacataggagagatg
agcttcctacagcacaacaaatgtgaatgcagaccaaagaaagatagagcaagacaagaa
aaaaaatcagttcgaggaaagggaaaggggcaaaaacgaaagcgcaagaaatcccggtat
aagtcctggagcgttccctgtgggccttgctcagagcggagaaagcatttgtttgtacaa
gatccgcagacgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcag
cttgagttaaacgaacgtacttgcagatgtgacaagccgaggcggtga

DBGET integrated database retrieval system