KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104667372
Entry
104667372         CDS       T03989                                 

Gene name
RHOA
Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04144  Endocytosis
rro04150  mTOR signaling pathway
rro04270  Vascular smooth muscle contraction
rro04310  Wnt signaling pathway
rro04350  TGF-beta signaling pathway
rro04360  Axon guidance
rro04510  Focal adhesion
rro04520  Adherens junction
rro04530  Tight junction
rro04611  Platelet activation
rro04621  NOD-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04660  T cell receptor signaling pathway
rro04670  Leukocyte transendothelial migration
rro04722  Neurotrophin signaling pathway
rro04810  Regulation of actin cytoskeleton
rro04921  Oxytocin signaling pathway
rro04928  Parathyroid hormone synthesis, secretion and action
rro04972  Pancreatic secretion
rro05100  Bacterial invasion of epithelial cells
rro05132  Salmonella infection
rro05133  Pertussis
rro05135  Yersinia infection
rro05152  Tuberculosis
rro05163  Human cytomegalovirus infection
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05210  Colorectal cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    104667372 (RHOA)
   04015 Rap1 signaling pathway
    104667372 (RHOA)
   04310 Wnt signaling pathway
    104667372 (RHOA)
   04350 TGF-beta signaling pathway
    104667372 (RHOA)
   04072 Phospholipase D signaling pathway
    104667372 (RHOA)
   04071 Sphingolipid signaling pathway
    104667372 (RHOA)
   04024 cAMP signaling pathway
    104667372 (RHOA)
   04022 cGMP-PKG signaling pathway
    104667372 (RHOA)
   04150 mTOR signaling pathway
    104667372 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104667372 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104667372 (RHOA)
   04520 Adherens junction
    104667372 (RHOA)
   04530 Tight junction
    104667372 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104667372 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104667372 (RHOA)
   04621 NOD-like receptor signaling pathway
    104667372 (RHOA)
   04625 C-type lectin receptor signaling pathway
    104667372 (RHOA)
   04660 T cell receptor signaling pathway
    104667372 (RHOA)
   04670 Leukocyte transendothelial migration
    104667372 (RHOA)
   04062 Chemokine signaling pathway
    104667372 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104667372 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    104667372 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104667372 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    104667372 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104667372 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    104667372 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104667372 (RHOA)
   05206 MicroRNAs in cancer
    104667372 (RHOA)
   05205 Proteoglycans in cancer
    104667372 (RHOA)
   05203 Viral carcinogenesis
    104667372 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104667372 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104667372 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104667372 (RHOA)
   05135 Yersinia infection
    104667372 (RHOA)
   05133 Pertussis
    104667372 (RHOA)
   05152 Tuberculosis
    104667372 (RHOA)
   05100 Bacterial invasion of epithelial cells
    104667372 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104667372 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104667372 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104667372 (RHOA)
   04031 GTP-binding proteins [BR:rro04031]
    104667372 (RHOA)
Membrane trafficking [BR:rro04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    104667372 (RHOA)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104667372 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   104667372 (RHOA)
  Exosomal proteins of colorectal cancer cells
   104667372 (RHOA)
  Exosomal proteins of bladder cancer cells
   104667372 (RHOA)
GTP-binding proteins [BR:rro04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    104667372 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 104667372
NCBI-ProteinID: XP_030797477
LinkDB
Position
1
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatccggaagaaactagtgattgttggtgatggagcctgtggaaagacatgc
ttgctcatagtgttcagcaaggaccagttcccagaggtgtatgtgcccacagtgtttgag
aactatgtggcagatatcgaggtggatggaaaacaggtagagttggctttgtgggacaca
gctgggcaggaagattatgatcgcctgaggcccctctcctacccagataccgatgttata
ctgatgtgtttttccatcgacagccctgatagtttagaaaacatcccagaaaagtggacc
ccggaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaataagaaggat
cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtgaaa
cctgaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagagaggtttttgaaatggctacgagagctgctctgcaa
gctagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system