KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668007
Entry
104668007         CDS       T03989                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04024  cAMP signaling pathway
rro04068  FoxO signaling pathway
rro04071  Sphingolipid signaling pathway
rro04137  Mitophagy - animal
rro04140  Autophagy - animal
rro04141  Protein processing in endoplasmic reticulum
rro04210  Apoptosis
rro04215  Apoptosis - multiple species
rro04217  Necroptosis
rro04310  Wnt signaling pathway
rro04380  Osteoclast differentiation
rro04510  Focal adhesion
rro04530  Tight junction
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04657  IL-17 signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04668  TNF signaling pathway
rro04722  Neurotrophin signaling pathway
rro04723  Retrograde endocannabinoid signaling
rro04728  Dopaminergic synapse
rro04750  Inflammatory mediator regulation of TRP channels
rro04910  Insulin signaling pathway
rro04912  GnRH signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04917  Prolactin signaling pathway
rro04920  Adipocytokine signaling pathway
rro04926  Relaxin signaling pathway
rro04930  Type II diabetes mellitus
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro05010  Alzheimer disease
rro05012  Parkinson disease
rro05016  Huntington disease
rro05017  Spinocerebellar ataxia
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05133  Pertussis
rro05135  Yersinia infection
rro05142  Chagas disease
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05161  Hepatitis B
rro05162  Measles
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05231  Choline metabolism in cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104668007 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104668007 (MAPK10)
   04012 ErbB signaling pathway
    104668007 (MAPK10)
   04014 Ras signaling pathway
    104668007 (MAPK10)
   04310 Wnt signaling pathway
    104668007 (MAPK10)
   04668 TNF signaling pathway
    104668007 (MAPK10)
   04068 FoxO signaling pathway
    104668007 (MAPK10)
   04071 Sphingolipid signaling pathway
    104668007 (MAPK10)
   04024 cAMP signaling pathway
    104668007 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104668007 (MAPK10)
   04137 Mitophagy - animal
    104668007 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    104668007 (MAPK10)
   04215 Apoptosis - multiple species
    104668007 (MAPK10)
   04217 Necroptosis
    104668007 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104668007 (MAPK10)
   04530 Tight junction
    104668007 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104668007 (MAPK10)
   04621 NOD-like receptor signaling pathway
    104668007 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    104668007 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    104668007 (MAPK10)
   04660 T cell receptor signaling pathway
    104668007 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    104668007 (MAPK10)
   04659 Th17 cell differentiation
    104668007 (MAPK10)
   04657 IL-17 signaling pathway
    104668007 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    104668007 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104668007 (MAPK10)
   04920 Adipocytokine signaling pathway
    104668007 (MAPK10)
   04912 GnRH signaling pathway
    104668007 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    104668007 (MAPK10)
   04917 Prolactin signaling pathway
    104668007 (MAPK10)
   04926 Relaxin signaling pathway
    104668007 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    104668007 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    104668007 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    104668007 (MAPK10)
   04722 Neurotrophin signaling pathway
    104668007 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104668007 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104668007 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104668007 (MAPK10)
   05231 Choline metabolism in cancer
    104668007 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104668007 (MAPK10)
   05212 Pancreatic cancer
    104668007 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104668007 (MAPK10)
   05012 Parkinson disease
    104668007 (MAPK10)
   05016 Huntington disease
    104668007 (MAPK10)
   05017 Spinocerebellar ataxia
    104668007 (MAPK10)
   05020 Prion disease
    104668007 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    104668007 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104668007 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    104668007 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    104668007 (MAPK10)
   04931 Insulin resistance
    104668007 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104668007 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104668007 (MAPK10)
   05135 Yersinia infection
    104668007 (MAPK10)
   05133 Pertussis
    104668007 (MAPK10)
   05152 Tuberculosis
    104668007 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104668007 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    104668007 (MAPK10)
   05161 Hepatitis B
    104668007 (MAPK10)
   05171 Coronavirus disease - COVID-19
    104668007 (MAPK10)
   05162 Measles
    104668007 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104668007 (MAPK10)
   05169 Epstein-Barr virus infection
    104668007 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104668007 (MAPK10)
   05142 Chagas disease
    104668007 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104668007 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104668007 (MAPK10)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104668007 (MAPK10)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104668007 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 104668007
NCBI-ProteinID: XP_010368912
LinkDB
Position
2
AA seq 464 aa
MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagcctccatttcttatactactgcagtgaaccaacattggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccagttctacagtgtggaagtgggagactcaaccttcacagtt
ctcaagcgctaccagaatctaaagcctattggctctggggctcaggggatagtttgtgcc
gcgtatgatgctgtccttgatagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacccatgccaagagagcataccgggagctggtcctcatgaagtgtgtgaaccat
aaaaacattattagtttattaaatgtcttcacaccccagaaaacgctggaggagttccaa
gatgtttacttagtaatggaactgatggatgccaacttatgtcaagtgattcagatggaa
ttagaccacgagcgaatgtcttacctgctgtaccaaatgctgtgtggcattaagcacctc
cactctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaagtctgat
tgcacattgaaaatcctggactttggactggccaggacagcaggcacaagcttcatgatg
actccatatgtggtgacacgttattacagagcccccgaggtcatcctggggatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctctttccaggaagggactatattgaccagtggaataaggtaattgaacaactagga
acaccatgtccagaattcatgaagaaattgcaacccacagtaagaaactatgtggagaat
cggcccaagtatgcgggactcaccttccccaagctcttcccagattccctcttcccagcg
gactccgagcacaataaactcaaagccagccaagccagggacttgttgtcaaagatgcta
gtgattgacccagcaaaaagaatatcagtggatgacgccttacagcatccctacatcaac
gtctggtatgacccagccgaagtggaggcgcctccacctcagatatatgacaagcagttg
gatgaaagagaacacacaatcgaagaatggaaagaacttatctacaaggaagtaatgaac
tcagaagagaagactaaaaatggcgtagtaaaaggacagccttctccttcaggtgcagca
gtgaacagcagtgagagtctccctccatcctcgtctgtcaatgacatctcctccatgtcc
accgaccagaccctggcatctgacactgacagcagcctggaagcttcggcaggacccctg
ggttgttgcaggtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104676194
Entry
104676194         CDS       T03989                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04024  cAMP signaling pathway
rro04068  FoxO signaling pathway
rro04071  Sphingolipid signaling pathway
rro04137  Mitophagy - animal
rro04140  Autophagy - animal
rro04141  Protein processing in endoplasmic reticulum
rro04210  Apoptosis
rro04215  Apoptosis - multiple species
rro04217  Necroptosis
rro04310  Wnt signaling pathway
rro04380  Osteoclast differentiation
rro04510  Focal adhesion
rro04530  Tight junction
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04657  IL-17 signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04668  TNF signaling pathway
rro04722  Neurotrophin signaling pathway
rro04723  Retrograde endocannabinoid signaling
rro04728  Dopaminergic synapse
rro04750  Inflammatory mediator regulation of TRP channels
rro04910  Insulin signaling pathway
rro04912  GnRH signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04917  Prolactin signaling pathway
rro04920  Adipocytokine signaling pathway
rro04926  Relaxin signaling pathway
rro04930  Type II diabetes mellitus
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro05010  Alzheimer disease
rro05012  Parkinson disease
rro05016  Huntington disease
rro05017  Spinocerebellar ataxia
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05133  Pertussis
rro05135  Yersinia infection
rro05142  Chagas disease
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05161  Hepatitis B
rro05162  Measles
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05231  Choline metabolism in cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104676194 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104676194 (MAPK9)
   04012 ErbB signaling pathway
    104676194 (MAPK9)
   04014 Ras signaling pathway
    104676194 (MAPK9)
   04310 Wnt signaling pathway
    104676194 (MAPK9)
   04668 TNF signaling pathway
    104676194 (MAPK9)
   04068 FoxO signaling pathway
    104676194 (MAPK9)
   04071 Sphingolipid signaling pathway
    104676194 (MAPK9)
   04024 cAMP signaling pathway
    104676194 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104676194 (MAPK9)
   04137 Mitophagy - animal
    104676194 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    104676194 (MAPK9)
   04215 Apoptosis - multiple species
    104676194 (MAPK9)
   04217 Necroptosis
    104676194 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104676194 (MAPK9)
   04530 Tight junction
    104676194 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104676194 (MAPK9)
   04621 NOD-like receptor signaling pathway
    104676194 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    104676194 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    104676194 (MAPK9)
   04660 T cell receptor signaling pathway
    104676194 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    104676194 (MAPK9)
   04659 Th17 cell differentiation
    104676194 (MAPK9)
   04657 IL-17 signaling pathway
    104676194 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    104676194 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104676194 (MAPK9)
   04920 Adipocytokine signaling pathway
    104676194 (MAPK9)
   04912 GnRH signaling pathway
    104676194 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    104676194 (MAPK9)
   04917 Prolactin signaling pathway
    104676194 (MAPK9)
   04926 Relaxin signaling pathway
    104676194 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    104676194 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    104676194 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    104676194 (MAPK9)
   04722 Neurotrophin signaling pathway
    104676194 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104676194 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104676194 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104676194 (MAPK9)
   05231 Choline metabolism in cancer
    104676194 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104676194 (MAPK9)
   05212 Pancreatic cancer
    104676194 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104676194 (MAPK9)
   05012 Parkinson disease
    104676194 (MAPK9)
   05016 Huntington disease
    104676194 (MAPK9)
   05017 Spinocerebellar ataxia
    104676194 (MAPK9)
   05020 Prion disease
    104676194 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    104676194 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104676194 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    104676194 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    104676194 (MAPK9)
   04931 Insulin resistance
    104676194 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104676194 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104676194 (MAPK9)
   05135 Yersinia infection
    104676194 (MAPK9)
   05133 Pertussis
    104676194 (MAPK9)
   05152 Tuberculosis
    104676194 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104676194 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    104676194 (MAPK9)
   05161 Hepatitis B
    104676194 (MAPK9)
   05171 Coronavirus disease - COVID-19
    104676194 (MAPK9)
   05162 Measles
    104676194 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104676194 (MAPK9)
   05169 Epstein-Barr virus infection
    104676194 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104676194 (MAPK9)
   05142 Chagas disease
    104676194 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104676194 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104676194 (MAPK9)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104676194 (MAPK9)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104676194 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 104676194
NCBI-ProteinID: XP_030782883
LinkDB
Position
3
AA seq 424 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagcgacagtaaatgtgacagtcagttttacagtgtgcaagtggcagactcaaccttc
actgtcctaaaacgttaccagcagctgaaaccaattggctctggggcccaagggattgtt
tgtgctgcatttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaaccaaactcatgcaaagagagcttatcgtgaactcgtcctcttaaaatgtgtc
aatcataaaaatattattagtttgttaaatgtgtttacaccacaaaaaactctagaagaa
tttcaagatgtgtatttggttatggagttaatggatgctaacttatgtcaagttattcac
atggagctggatcatgaaagaatgtcctaccttctttaccagatgctttgtggtattaaa
catctgcattcagctggtataattcatagagatttgaagcctagcaacatcgttgtgaaa
tcagactgcaccctgaagatccttgactttggcctggcccggacggcctgcaccaacttc
atgatgaccccttacgtggtaacccggtactaccgggcgcccgaagtcatcctgggtatg
ggctacaaagagaacgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtgatattccaaggcactgaccatattgatcagtggaataaagtcattgagcag
cttggaacaccatcagcagagttcatgaagaaactccagccaactgtgaggaattatgta
gaaaacagaccaaagtatcctggaatcaaattcgaagaactctttccagattggatattc
ccatcagagtctgagcgagacaaaataaaaacaagtcaagccagagatctgttatcgaaa
atgctagtgattgatcctgacaagcggatctctgtagatgaagctctgcgtcacccatac
atcactgtctggtacgaccccgccgaagcagaggcaccaccacctcagatttatgatgcc
cagttggaagaaagagaacatgcaattgaagaatggaaagagctaatttacaaagaagtc
atggattgggaagaaagaagcaagaatggtgttgtaaaagatcagccttcagatgcagca
gtaagtagcaacgccactccttctcagtcttcatctatcaatgacatttcatccatgtcc
actgagcagacactggcctcagacacagacagcagtcttgatgcctcgacgggacccctt
gaaggttgtcgatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104678447
Entry
104678447         CDS       T03989                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04024  cAMP signaling pathway
rro04068  FoxO signaling pathway
rro04071  Sphingolipid signaling pathway
rro04137  Mitophagy - animal
rro04140  Autophagy - animal
rro04141  Protein processing in endoplasmic reticulum
rro04210  Apoptosis
rro04215  Apoptosis - multiple species
rro04217  Necroptosis
rro04310  Wnt signaling pathway
rro04380  Osteoclast differentiation
rro04510  Focal adhesion
rro04530  Tight junction
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04657  IL-17 signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04668  TNF signaling pathway
rro04722  Neurotrophin signaling pathway
rro04723  Retrograde endocannabinoid signaling
rro04728  Dopaminergic synapse
rro04750  Inflammatory mediator regulation of TRP channels
rro04910  Insulin signaling pathway
rro04912  GnRH signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04917  Prolactin signaling pathway
rro04920  Adipocytokine signaling pathway
rro04926  Relaxin signaling pathway
rro04930  Type II diabetes mellitus
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro05010  Alzheimer disease
rro05012  Parkinson disease
rro05016  Huntington disease
rro05017  Spinocerebellar ataxia
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05133  Pertussis
rro05135  Yersinia infection
rro05142  Chagas disease
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05161  Hepatitis B
rro05162  Measles
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05231  Choline metabolism in cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104678447 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104678447 (MAPK8)
   04012 ErbB signaling pathway
    104678447 (MAPK8)
   04014 Ras signaling pathway
    104678447 (MAPK8)
   04310 Wnt signaling pathway
    104678447 (MAPK8)
   04668 TNF signaling pathway
    104678447 (MAPK8)
   04068 FoxO signaling pathway
    104678447 (MAPK8)
   04071 Sphingolipid signaling pathway
    104678447 (MAPK8)
   04024 cAMP signaling pathway
    104678447 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104678447 (MAPK8)
   04137 Mitophagy - animal
    104678447 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    104678447 (MAPK8)
   04215 Apoptosis - multiple species
    104678447 (MAPK8)
   04217 Necroptosis
    104678447 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104678447 (MAPK8)
   04530 Tight junction
    104678447 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104678447 (MAPK8)
   04621 NOD-like receptor signaling pathway
    104678447 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    104678447 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    104678447 (MAPK8)
   04660 T cell receptor signaling pathway
    104678447 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    104678447 (MAPK8)
   04659 Th17 cell differentiation
    104678447 (MAPK8)
   04657 IL-17 signaling pathway
    104678447 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    104678447 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104678447 (MAPK8)
   04920 Adipocytokine signaling pathway
    104678447 (MAPK8)
   04912 GnRH signaling pathway
    104678447 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    104678447 (MAPK8)
   04917 Prolactin signaling pathway
    104678447 (MAPK8)
   04926 Relaxin signaling pathway
    104678447 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    104678447 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    104678447 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    104678447 (MAPK8)
   04722 Neurotrophin signaling pathway
    104678447 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104678447 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104678447 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104678447 (MAPK8)
   05231 Choline metabolism in cancer
    104678447 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104678447 (MAPK8)
   05212 Pancreatic cancer
    104678447 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104678447 (MAPK8)
   05012 Parkinson disease
    104678447 (MAPK8)
   05016 Huntington disease
    104678447 (MAPK8)
   05017 Spinocerebellar ataxia
    104678447 (MAPK8)
   05020 Prion disease
    104678447 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    104678447 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104678447 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    104678447 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    104678447 (MAPK8)
   04931 Insulin resistance
    104678447 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104678447 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104678447 (MAPK8)
   05135 Yersinia infection
    104678447 (MAPK8)
   05133 Pertussis
    104678447 (MAPK8)
   05152 Tuberculosis
    104678447 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104678447 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    104678447 (MAPK8)
   05161 Hepatitis B
    104678447 (MAPK8)
   05171 Coronavirus disease - COVID-19
    104678447 (MAPK8)
   05162 Measles
    104678447 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104678447 (MAPK8)
   05169 Epstein-Barr virus infection
    104678447 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104678447 (MAPK8)
   05142 Chagas disease
    104678447 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104678447 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104678447 (MAPK8)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104678447 (MAPK8)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104678447 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 104678447
NCBI-ProteinID: XP_030796639
LinkDB
Position
11
AA seq 427 aa
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVISGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAST
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacaacaatttttatagtgtagagattggagattctacattc
acagtcctgaaacggtatcagaatttaaaacctataggctcaggagcgcaaggaatagta
tgcgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccgacca
tttcagaatcagactcatgccaagcgggcctacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggagctagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaaacccagtaatatagtagtaaaa
tctgactgcactttgaagattcttgacttcggtctggccaggactgcaggaacgagtttt
atgatgacgccttatgtagtgactcgctactacagagcacccgaggtcatccttggcatg
ggctacaaggaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaaactgcaaccaacagtaaggacttatgtt
gaaaacagacctaaatatgctggatatagcttcgaaaaacttttccctgatgtacttttc
ccagctgactcggaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaatagatgcatctaaaaggatctctgtagatgaagctctccaacacccgtac
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatccctgacaag
cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatataaggaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcagtggctctcagcatccatcgtcatcgtcgtctgtcaatgatgtgtct
tcaatgtcaacagatccgactttggcctcggatacagacagcagtctagaagcatcaact
gggcctctgggctgctgtagatga

DBGET integrated database retrieval system