KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668074
Entry
104668074         CDS       T03989                                 

Gene name
JAK1
Definition
(RefSeq) tyrosine-protein kinase JAK1 isoform X1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro04151  PI3K-Akt signaling pathway
rro04217  Necroptosis
rro04380  Osteoclast differentiation
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04621  NOD-like receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro05140  Leishmaniasis
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05212  Pancreatic cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104668074 (JAK1)
   04151 PI3K-Akt signaling pathway
    104668074 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104668074 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104668074 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104668074 (JAK1)
   04658 Th1 and Th2 cell differentiation
    104668074 (JAK1)
   04659 Th17 cell differentiation
    104668074 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104668074 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104668074 (JAK1)
   05203 Viral carcinogenesis
    104668074 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104668074 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    104668074 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104668074 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104668074 (JAK1)
   05161 Hepatitis B
    104668074 (JAK1)
   05160 Hepatitis C
    104668074 (JAK1)
   05171 Coronavirus disease - COVID-19
    104668074 (JAK1)
   05164 Influenza A
    104668074 (JAK1)
   05162 Measles
    104668074 (JAK1)
   05168 Herpes simplex virus 1 infection
    104668074 (JAK1)
   05163 Human cytomegalovirus infection
    104668074 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104668074 (JAK1)
   05169 Epstein-Barr virus infection
    104668074 (JAK1)
   05165 Human papillomavirus infection
    104668074 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104668074 (JAK1)
   05140 Leishmaniasis
    104668074 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104668074 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104668074 (JAK1)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     104668074 (JAK1)
Protein kinases [BR:rro01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   104668074 (JAK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 SH2
Other DBs
NCBI-GeneID: 104668074
NCBI-ProteinID: XP_010369011
UniProt: A0A2K6RHP9
LinkDB
Position
12
AA seq 1154 aa
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYMSDREPLRLGSGEYTAEEL
CIRAAQACRISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHSNDSGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKSKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEQVQGAQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFML
KRCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSG
TLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRD
VENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNL
LLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFG
TTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRA
IMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDN
TGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLP
SGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIG
DFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDS
DSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRT
SFQNLIEGFEALLK
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agctccaagaagactgaggtgaacctggaggcccctgagccaggggtggaagtgatcttc
tatatgtcggacagggagcccctccggctgggcagtggagagtacacagcagaggaactg
tgcatcagggctgcacaggcatgccgtatctcccctctttgtcacaacctctttgccctg
tatgatgagaacaccaagctctggtatgctccaaatcgcaccatcaccgttgatgacaag
atgtccctccgactccactaccggatgaggttctatttcaccaattggcatggaaccaac
gacaatgagcagtcagtgtggcgtcattctccaaagaagcagaaaaatggctatgagaaa
aaaaaggttccagatgcaacccctctccttgatgccagctcactggagtatctctttgct
cagggacagtatgatttggtgaaatgcctggctcccattcgagaccccaagaccgagcag
gatgggcatgatattgaaaacgagtgtctggggatggctgtcctggccatctcacactat
gccatgatgaagaagatgcagttgccagaactgcccaaggacatcagctacaagcgatat
attccagaaacattgaataagtccatcagacagaggaaccttctcaccaggatgcggata
aataatgttttcaaggatttcctaaaggaatttaacaacaagaccatttgtgacagcagc
gtgtccacgcatgacctgaaggtgaaatacttggctaccttggaaactttgacaaaacat
tatggcgctgaaatatttgagacttccatgttactgatttcatcagaaaatgagatgaat
tggtttcattcaaatgacagtggaaacgttctgtactatgaagtgatggtgactgggaat
cttggaatccagtggaggcataaaccaaatgttgtttctgttgaaaaggaaaaaagtaaa
ctgaagcggaaaaaactggaaaataaacacaagaaggatgaggagaaaaacaagatccgg
gaagagtggaacaatttttcttatttccctgaaatcactcacattgtaataaaggagtct
gtggtcagcattaacaagcaggacaacaagaaaatggaactgaagctctcttctcatgag
gaggccttgtcctttgtgtcactggtagatggctacttccggctcaccgcagacgcccat
cattacctctgcaccgacgtggcccccccgttgatcgtccacaacatacagaatggctgt
catggtccaatctgtacagaatacgccatcaataaattgcggcaagaaggaagcgaggag
gggatgtacgtgctgaggtggagctgcaccgactttgacaacatcctcatgaccgtcacc
tgctttgagaagtctgagcaggtgcagggtgcccagaagcagttcaagaactttcagatc
gaggtgcagaagggccgctacagcctgcacggttcggaccgcagcttccccagcttggga
gacctcatgagccacctcaagaagcagatcctgcgcacggataacatcagcttcatgttg
aaacgctgctgccagcccaagccccgagaaatctccaacctgctggtggctactaagaaa
gcccaggagtggcaacccgtctaccccatgagccagctgagttttgatcggatcctcaag
aaggatctggtgcagggcgagcaccttgggagaggcacgagaacacacatctactctggg
accctgatggattacaaggatgatgaaggaacttctgaagagaagaagataaaagtgatc
ctcaaagtcttagaccccagccacagggatatttccctggccttcttcgaggcagccagc
atgatgagacaggtctcccacaaacacatcgtgtacctctatggcgtctgtgtccgcgac
gtggagaatatcatggtggaagagtttgtggaagggggtcctctggatctcttcatgcac
cggaaaagtgatgtccttactacaccctggaaattcaaagttgccaaacagctggccagt
gccctgagctacttggaagataaagacctggtccatggaaatgtgtgtactaaaaacctc
ctcctggcccgtgagggcatcgacagcgagtgtggtccgttcatcaagctcagtgaccct
ggcatccccattacggtgctgtctaggcaagagtgcattgaacgaatcccgtggattgct
cccgagtgtgttgaggactccaagaacctgagcgtggctgctgacaagtggagctttgga
actacgctctgggaaatctgctacaatggcgagatccccttgaaagacaagacactgatt
gagaaagagagattctatgaaagccggtgcaggccagtgacaccatcatgtaaggagctg
gctgacctcatgacccgctgcatgaactatgaccccaatcagaggcccttcttccgagcc
atcatgagagacattaataagcttgaagagcagaatccagatattgtttcagaaaaaaag
ccagcaactgaagtggaccccacgcattttgaaaagcgcttcctaaagaggatccgtgac
ttgggagagggccactttgggaaggttgagctctgcaggtatgaccccgaaggggacaat
acaggggagcaggtggctgtcaaatctctgaagcctgagagtggaggtaaccacatagct
gatctgaaaaaggaaatcgagatcttaaggaacctctatcacgagaacattgtgaagtac
aaaggaatctgcacggaagatggaggaaatggtattaagctcatcatggaatttctgcct
tcgggaagccttaaggagtatcttccaaagaataagaacaaaattaacctcaaacagcag
ctaaaatatgccgttcagatttgtaaggggatggactatttgggttctcggcaatatgtt
caccgtgacttggcagcaagaaatgtccttgttgagagtgaacaccaagtgaaaattgga
gacttcggtttaaccaaagcaattgaaactgataaggagtattacaccgtcaaggatgac
cgggacagccctgtgttttggtatgctccagaatgtttaatgcaatctaaattttatatc
gcctctgacgtctggtcttttggagtcactctgcatgagctgctgacttactgtgattca
gattctagtcccatggccttgttcctgaaaatgataggcccaacccatggccagatgaca
gtcacaagacttgtgaatacattaaaagaaggaaaacgcctgccgtgcccacctaactgt
ccagatgaggtttatcaacttatgaggaaatgctgggaattccaaccatccaatcggaca
agctttcagaaccttattgaaggatttgaagcacttttaaaataa

DBGET integrated database retrieval system