KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668178
Entry
104668178         CDS       T03989                                 

Gene name
AR
Definition
(RefSeq) androgen receptor
  KO
K08557  androgen receptor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04114  Oocyte meiosis
rro05200  Pathways in cancer
rro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104668178 (AR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104668178 (AR)
  09162 Cancer: specific types
   05215 Prostate cancer
    104668178 (AR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104668178 (AR)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rro03310]
    104668178 (AR)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    104668178 (AR)
Nuclear receptors [BR:rro03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   104668178 (AR)
SSDB
Motif
Pfam: Androgen_recep Hormone_recep zf-C4 U3_snoRNA_assoc
Other DBs
NCBI-GeneID: 104668178
NCBI-ProteinID: XP_030790396
LinkDB
Position
7
AA seq 904 aa
MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLQQQQQ
QQQQQQQETSPRQRQQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSAPECHPERG
CVPEPGAAVAAGKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLKDILSEAST
MQLLQQQQQEAVSEGSSNGRAREASGAPTSSKDNYLGGTSTISDSAKELCKAVSVSMGLG
VEALEHLSPGEQLRGDCMYAPVLGVPPSVRPTPCAPLAECKGSLLDDRAGKSTEDTAEYS
PFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLA
LAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGTGAAGPGSGSPSAA
ASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGAGEAGAVAPYGYTRPPQGLAGQEGD
FTAPDVWYPGGMVSRVPYPSPTCVKSEMSPWMDSYSGPYGDMRLETARDHVLPIDYYFPP
QKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCR
LRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETAQKLTVSHIEGYECQPIFLN
VLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMA
VIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFG
WLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRR
FYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIY
FHTQ
NT seq 2715 nt   +upstreamnt  +downstreamnt
atggaggtgcagttagggctggggagggtctaccctcggccgccgtccaagacctaccga
ggagctttccagaatctgttccagagcgtgcgcgaagtgatccagaacccgggccccagg
cacccagaggccgcgagcgcagcacctcccggcgccagtttgctgcagcagcagcagcag
cagcagcagcagcaacaacaagaaactagccctcggcagcggcagcagcagcagcagcag
cagggtgaggatggttctccccaagcccatcgtagaggccccacaggctacctggtcctg
gatgaggaacagcagccttcacagcctcagtcagccccggagtgccaccccgagagaggc
tgcgttccagagcctggagccgccgtggccgccggcaaggggctgccgcagcagctgcca
gcacctccggacgaggatgactcagctgccccatccacgttgtccctgctgggccccact
ttccccggcttaagcagctgctccgccgaccttaaagacatcctgagcgaggccagcacc
atgcaactccttcagcaacagcagcaggaagcagtatccgaaggcagcagcaacgggaga
gcgagggaggcctcgggggctcccacttcctccaaggacaattacttagggggcacttcg
accatttctgacagcgccaaggagttgtgtaaggcagtgtcggtgtccatgggcttgggt
gtggaggcgttggagcatctgagtccaggggaacagcttcggggggattgcatgtacgcc
ccagttttgggagttccaccctccgtgcgtcccactccgtgtgccccattggccgaatgc
aaaggttctctgctagacgacagagcaggcaagagcactgaagatactgctgagtattcc
cctttcaagggaggttacaccaaagggctagaaggtgagagcctaggctgctctggcagc
gctgcagccgggagctccgggacacttgaactgccgtccaccctgtctctctacaagtcc
ggagcactggacgaggcagctgcgtaccagagtcgcgactactacaactttccactggct
ctggccgggccgccgccccctccgccgcctccccatccccacgctcgcatcaagctggag
aacccgctggactatggcagcgcctgggcggctgcggcggcgcagtgccgctatggggac
ctggcgagcctgcatggcacgggtgcagcgggacccggctctgggtcaccctcagccgct
gcttcctcatcctggcacacgctcttcacagccgaagaaggccagttgtatggaccctgt
ggtggtgggggcggcggcggtggcggcggcggcggcggtggcggcgcaggcgaggcggga
gctgtagccccctacggctacactcggccacctcaggggctggcgggccaggaaggcgac
ttcaccgcacctgatgtgtggtaccctggcggcatggtgagcagagtgccctatcccagt
cccacttgtgtcaaaagcgagatgagcccctggatggatagctactccggaccttatggg
gacatgcgtttggagactgccagggaccatgttttgcccattgactattactttccaccc
cagaagacctgcctgatctgtggagatgaagcttctgggtgtcactatggagctctcaca
tgtggaagctgcaaggtcttcttcaaaagagccgctgaagggaaacagaagtacctgtgt
gccagcagaaatgattgcactattgataaattccgaaggaaaaattgtccatcttgccgt
cttcggaaatgttatgaagcagggatgactctgggagcccggaagctgaagaaacttggt
aatctgaaactacaggaggaaggagaggcttccagcaccaccagccccactgaggagaca
gcccagaagctgacagtgtcacacattgaaggctatgaatgtcagcccatctttctgaat
gtcctggaagccattgagccaggtgtggtgtgtgctggacacgacaacaaccagcccgac
tccttcgcagccttgctctctagcctcaatgaactgggagagagacagcttgtacatgtg
gtcaagtgggccaaggccttgcctggcttccgcaacttgcatgtggacgaccagatggct
gtcattcagtactcctggatggggctcatggtgtttgccatgggctggcgatccttcacc
aatgtcaactccaggatgctctacttcgcccctgatctggttttcaatgagtaccgcatg
cacaagtcccggatgtacagccagtgtgtccgaatgaggcacctctctcaagagtttgga
tggctccaaatcaccccccaggaattcctgtgcatgaaagcgctgctactcttcagcatt
attccagtggatggactgaaaaatcaaaaattctttgatgaacttcgaatgaactacatc
aaggaactcgatcgtatcattgcatgcaaaagaaaaaatcccacatcctgctcaaggcgt
ttctaccagctcaccaagctcctggactccgtgcagcctattgcgagagagctgcatcag
ttcacttttgacctgctaatcaagtcacacatggtgagcgtggactttccggaaatgatg
gcagagatcatctctgtgcaagtgcccaagatcctttctgggaaagtcaagcccatctat
ttccatacccagtga

DBGET integrated database retrieval system