KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668214
Entry
104668214         CDS       T03989                                 

Gene name
NRG1
Definition
(RefSeq) pro-neuregulin-1, membrane-bound isoform isoform X5
  KO
K05455  neuregulin 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro04012  ErbB signaling pathway
rro05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104668214 (NRG1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    104668214 (NRG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104668214 (NRG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104668214 (NRG1)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104668214 (NRG1)
Cytokines and growth factors [BR:rro04052]
 Growth factors
  Growth factors (RTK binding)
   104668214 (NRG1)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   104668214 (NRG1)
SSDB
Motif
Pfam: Neuregulin I-set Ig_3 ig Ig_2 V-set EGF EGF_2 Ig_6 hEGF BiPBP_C Cyt_b-c1_8 Laminin_EGF
Other DBs
NCBI-GeneID: 104668214
NCBI-ProteinID: XP_010369156
UniProt: A0A2K6QJD6
LinkDB
Position
9
AA seq 640 aa
MSERKEGRGKGKGKKKERGSGKKPESAAGSQSPALPPRLKEMKSQESAAGSKLVLRCETS
SEYSSLRFKWFKNGNELNRKNKPQNIKIQKKPGKSELRISKASLADSGEYMCKVISKLGN
DSASANITIVDSNEIITGMPASTEGAYMSSESPIRISVSTEGANTSSSTSTSTTGTSHLV
KCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQ
KRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQSLRSERNNMMNIANGPHHPN
PPPENVQLVNQYVSKNVISSEHIVEREAETSFSTSHYTSTAHHSTTVTQTPSHSWSNGHT
ESILSESHSVIMMSSVENSRHSSPTGGPRGRLNGTGGPRECNSFLRHARETPDSYRDSPH
SERYVSAMTTPARMSPVDFHTPSSPKSPPSEMSPPVSSMTVSMPSMAVSPFVEEERPLLL
VTPPRLREKKFDHHPQQFSSFHHNPAHDSNSLPPSPLRIVEDEEYETTQEYEPAQEPVKK
LANSRRAKRTKPNGHIANRLEVDSNTSSQSSNSESETEDERVGEDTPFLGIQNPLAASLE
ATPAFRLADSRTNPAGRFSTQEEIQARLSSVIANQDPIAV
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgtccgagcgcaaagaaggcagaggcaaagggaagggcaagaagaaggagcgaggctcc
ggcaagaagcccgagtccgcggcgggcagtcagagcccagccttgcctccccgattgaaa
gagatgaaaagtcaggagtcggctgcaggttccaaactagtccttcgatgtgaaaccagt
tctgaatactcctctctcagattcaagtggttcaagaatgggaatgaattgaatcgaaaa
aacaaaccacaaaacatcaagatacaaaaaaagccagggaagtcagagcttcgcattagc
aaagcatcactggctgattctggagagtatatgtgcaaagtgatcagcaaattaggaaat
gacagtgcctctgccaatatcaccatcgtggattcaaacgagatcatcactggcatgcca
gcctcaactgaaggagcatatatgtcttcagagtctcccattagaatatcagtatcaaca
gaaggagcaaatacttcttcatctacatctacatccaccactgggacaagccatcttgta
aaatgcgcggagaaggagaaaactttctgtgtgaatggaggcgagtgcttcatggtgaaa
gacctttcaaacccctcgagatacttgtgcaagtgccaacctggattcactggagcaaga
tgtactgagaatgtgcccatgaaagtccaaaaccaagaaaaggcagaggagctgtaccag
aagagagtgctgaccataactggcatctgcatcgccctccttgtggttggcatcatgtgt
gtggtggcctactgcaaaaccaagaaacagcggaaaaagcttcatgaccgtcttcggcag
agccttcggtctgaacgaaacaatatgatgaacattgccaatgggcctcaccatcctaac
ccaccccccgagaatgtccagctggtgaatcaatatgtatctaaaaacgtcatctccagt
gagcatattgttgagagagaagcagagacatccttttccaccagtcactatacttccaca
gcccatcattccactactgtcacccagactcctagccacagctggagcaatggacatact
gaaagcatcctttccgaaagccactctgtaatcatgatgtcatccgtagaaaacagtagg
cacagcagcccaactgggggcccaagaggacgtcttaatggcacaggaggccctcgtgaa
tgtaacagcttcctcaggcatgccagagaaacccctgattcctaccgagactctcctcat
agtgaaaggtatgtgtcagccatgaccaccccggctcgtatgtcacctgtagatttccac
acgccaagctcccccaaatcacccccttcggaaatgtctccacccgtgtccagcatgacg
gtgtccatgccttccatggcggtcagccccttcgtggaagaagagagacctctacttctc
gtgacaccaccaaggctgcgggagaagaagtttgatcatcaccctcagcagttcagctcc
ttccatcacaaccccgcgcatgacagtaacagcctcccccctagccccttgaggatagtg
gaggatgaggagtatgaaaccacccaggagtacgagccagcccaagagcctgttaagaaa
ctcgccaatagccggcgggccaaaagaaccaagcccaatggccacattgctaacagattg
gaagtggacagcaacacaagctcccagagcagtaactcagagagcgaaacagaagatgaa
agagtaggtgaagatacacctttcctgggcatacagaaccccctggcagccagtcttgag
gcaacacctgccttccgcctggctgacagcaggactaacccagcaggccgcttctcgaca
caggaagaaatccaggccaggctgtctagtgtaattgctaaccaagaccctattgctgta
taa

DBGET integrated database retrieval system