KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668343
Entry
104668343         CDS       T03989                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B isoform X1
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro04012  ErbB signaling pathway
rro04066  HIF-1 signaling pathway
rro04068  FoxO signaling pathway
rro04110  Cell cycle
rro04151  PI3K-Akt signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04934  Cushing syndrome
rro05162  Measles
rro05165  Human papillomavirus infection
rro05169  Epstein-Barr virus infection
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05203  Viral carcinogenesis
rro05206  MicroRNAs in cancer
rro05215  Prostate cancer
rro05220  Chronic myeloid leukemia
rro05222  Small cell lung cancer
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104668343 (CDKN1B)
   04066 HIF-1 signaling pathway
    104668343 (CDKN1B)
   04068 FoxO signaling pathway
    104668343 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    104668343 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104668343 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104668343 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    104668343 (CDKN1B)
   05206 MicroRNAs in cancer
    104668343 (CDKN1B)
   05203 Viral carcinogenesis
    104668343 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    104668343 (CDKN1B)
   05220 Chronic myeloid leukemia
    104668343 (CDKN1B)
   05215 Prostate cancer
    104668343 (CDKN1B)
   05222 Small cell lung cancer
    104668343 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104668343 (CDKN1B)
   04934 Cushing syndrome
    104668343 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    104668343 (CDKN1B)
   05169 Epstein-Barr virus infection
    104668343 (CDKN1B)
   05165 Human papillomavirus infection
    104668343 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104668343 (CDKN1B)
SSDB
Motif
Pfam: CDI Multi-haem_cyto
Other DBs
NCBI-GeneID: 104668343
NCBI-ProteinID: XP_010369310
LinkDB
Position
10
AA seq 206 aa
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW
NFDFQNHRPLEGKYEWQEVEKGSLPEFYYRPPRPPKGTCKVPAQESQDVSGSRPAAPLIG
APANPEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDGNDPFPTDDSSTQNKRANRTEE
NVSDGSPNAGSVEQTPKKPGLRRRQT
NT seq 621 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagccctagcctagagcggatggacgccaggcag
gcggagcaccccaagccctcggcctgcaggaacctcttcggcccggtggaccacgaagag
ttaacccgggacttggagaagcactgcagagacatggaagaggcgagccagcgcaagtgg
aatttcgattttcagaatcacagacccctagagggcaagtacgagtggcaggaggtggag
aagggcagcttgcctgagttctactatagacccccgcggccccccaaaggcacctgcaag
gtgccggcgcaggagagccaggatgtcagcgggagccgcccggcggcgcctttaattggg
gctccggctaaccctgaggacacgcatttggtagacccaaagactgatccgtcggacagc
cagacggggttagcggagcagtgcgcaggaataaggaagcgacctgcaaccgacggtaat
gaccccttcccaaccgacgattcttccactcaaaacaaaagagccaacagaacagaagaa
aatgtttcagacggttccccaaatgccggttctgtggagcagacgcccaagaagcctggc
ctcagaagacgtcaaacgtaa

DBGET integrated database retrieval system